Recombinant Human CFTR protein, GST-tagged

Cat.No.: CFTR-275H
Product Overview: Recombinant Human CFTR fused with GST tag was expressed in E. coli.
Source: E. coli
Species: Human
Tag : GST
Form: 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0
AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE
MLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSYQIIRRTLKQAFADCTVILCEHRIEAML
ECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL
Storage: For long term storage, prepare aliquots and store at -20 ~ -80 centigrade. Avoid freeze/thaw cycles.
Gene Name: CFTR cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) [ Homo sapiens ]
Official Symbol: CFTR
Synonyms: CFTR; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); ABCC7, CF, cystic fibrosis transmembrane conductance regulator, ATP binding cassette (sub family C, member 7); cystic fibrosis transmembrane conductance regulator; ABC35; ATP binding cassette sub family C; member 7; CFTR/MRP; dJ760C5.1; MRP7; TNR CFTR; cAMP-dependent chloride channel; channel conductance-controlling ATPase; ATP-binding cassette sub-family C member 7; ATP-binding cassette transporter sub-family C member 7; CF; ABCC7; TNR-CFTR;
Gene ID: 1080
mRNA Refseq: NM_000492
Protein Refseq: NP_000483
MIM: 602421
UniProt ID: P13569
Chromosome Location: 7q31-q32
Pathway: ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem;
Function: ATP binding; ATP-binding and phosphorylation-dependent chloride channel activity; ATPase activity; PDZ domain binding; channel-conductance-controlling ATPase activity; chloride channel activity; enzyme binding; hydrolase activity; ion channel activity; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.