Recombinant Human CFTR protein, GST-tagged
| Cat.No. : | CFTR-275H |
| Product Overview : | Recombinant Human CFTR fused with GST tag was expressed in E. coli. |
| Availability | November 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Form : | 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0 |
| AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE MLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSYQIIRRTLKQAFADCTVILCEHRIEAML ECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL |
| Storage : | For long term storage, prepare aliquots and store at -20 ~ -80 centigrade. Avoid freeze/thaw cycles. |
| Publications : |
Cystic Fibrosis Transmembrane Conductance Regulator Attaches Tumor Suppressor PTEN to the Membrane and Promotes Anti Pseudomonas aeruginosa Immunity (2017)
|
| Gene Name | CFTR cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) [ Homo sapiens ] |
| Official Symbol | CFTR |
| Synonyms | CFTR; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); ABCC7, CF, cystic fibrosis transmembrane conductance regulator, ATP binding cassette (sub family C, member 7); cystic fibrosis transmembrane conductance regulator; ABC35; ATP binding cassette sub family C; member 7; CFTR/MRP; dJ760C5.1; MRP7; TNR CFTR; cAMP-dependent chloride channel; channel conductance-controlling ATPase; ATP-binding cassette sub-family C member 7; ATP-binding cassette transporter sub-family C member 7; CF; ABCC7; TNR-CFTR; |
| Gene ID | 1080 |
| mRNA Refseq | NM_000492 |
| Protein Refseq | NP_000483 |
| MIM | 602421 |
| UniProt ID | P13569 |
| Chromosome Location | 7q31-q32 |
| Pathway | ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; |
| Function | ATP binding; ATP-binding and phosphorylation-dependent chloride channel activity; ATPase activity; PDZ domain binding; channel-conductance-controlling ATPase activity; chloride channel activity; enzyme binding; hydrolase activity; ion channel activity; nucleotide binding; protein binding; |
| ◆ Recombinant Proteins | ||
| CFTR-10H | Recombinant Human CFTR-3C-eGFP Protein (M1-L1480 end), C-StrepII/10×His-tagged | +Inquiry |
| CFTR-2664H | Recombinant Human CFTR Protein, His (Fc)-Avi-tagged | +Inquiry |
| CFTR-592H | Recombinant Human CFTR | +Inquiry |
| CFTR-1780H | Recombinant Human CFTR protein, His & GST-tagged | +Inquiry |
| CFTR-1181H | Recombinant Human CFTR Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFTR Products
Required fields are marked with *
My Review for All CFTR Products
Required fields are marked with *
