Recombinant Human CFTR protein, GST-tagged
Cat.No. : | CFTR-275H |
Product Overview : | Recombinant Human CFTR fused with GST tag was expressed in E. coli. |
Availability | June 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Form : | 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0 |
AA Sequence : | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE MLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSYQIIRRTLKQAFADCTVILCEHRIEAML ECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL |
Storage : | For long term storage, prepare aliquots and store at -20 ~ -80 centigrade. Avoid freeze/thaw cycles. |
Publications : |
Cystic Fibrosis Transmembrane Conductance Regulator Attaches Tumor Suppressor PTEN to the Membrane and Promotes Anti Pseudomonas aeruginosa Immunity (2017)
|
Gene Name | CFTR cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) [ Homo sapiens ] |
Official Symbol | CFTR |
Synonyms | CFTR; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); ABCC7, CF, cystic fibrosis transmembrane conductance regulator, ATP binding cassette (sub family C, member 7); cystic fibrosis transmembrane conductance regulator; ABC35; ATP binding cassette sub family C; member 7; CFTR/MRP; dJ760C5.1; MRP7; TNR CFTR; cAMP-dependent chloride channel; channel conductance-controlling ATPase; ATP-binding cassette sub-family C member 7; ATP-binding cassette transporter sub-family C member 7; CF; ABCC7; TNR-CFTR; |
Gene ID | 1080 |
mRNA Refseq | NM_000492 |
Protein Refseq | NP_000483 |
MIM | 602421 |
UniProt ID | P13569 |
Chromosome Location | 7q31-q32 |
Pathway | ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem; |
Function | ATP binding; ATP-binding and phosphorylation-dependent chloride channel activity; ATPase activity; PDZ domain binding; channel-conductance-controlling ATPase activity; chloride channel activity; enzyme binding; hydrolase activity; ion channel activity; nucleotide binding; protein binding; |
◆ Recombinant Proteins | ||
CFTR-3993Z | Recombinant Zebrafish CFTR | +Inquiry |
CFTR-281H | Recombinant Human CFTR protein, His-tagged | +Inquiry |
CFTR-656R | Recombinant Rhesus Macaque CFTR Protein, His (Fc)-Avi-tagged | +Inquiry |
CFTR-280H | Recombinant Human CFTR protein, His-tagged | +Inquiry |
CFTR-12H | Recombinant Human CFTR Protein (Pro1181-End), N-His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CFTR Products
Required fields are marked with *
My Review for All CFTR Products
Required fields are marked with *
0
Inquiry Basket