Recombinant Human CFTR protein, GST-tagged

Cat.No. : CFTR-275H
Product Overview : Recombinant Human CFTR fused with GST tag was expressed in E. coli.
Availability August 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Form : 20 mM Tris-HCl, 0.15 M NaCl, pH 8.0
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPE
MLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSYQIIRRTLKQAFADCTVILCEHRIEAML
ECQQFLVIEENKVRQYDSIQKLLNERSLFRQAISPSDRVKLFPHRNSSKCKSKPQIAALKEETEEEVQDTRL
Storage : For long term storage, prepare aliquots and store at -20 ~ -80 centigrade. Avoid freeze/thaw cycles.
Publications :
Cystic Fibrosis Transmembrane Conductance Regulator Attaches Tumor Suppressor PTEN to the Membrane and Promotes Anti Pseudomonas aeruginosa Immunity (2017)
Gene Name CFTR cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7) [ Homo sapiens ]
Official Symbol CFTR
Synonyms CFTR; cystic fibrosis transmembrane conductance regulator (ATP-binding cassette sub-family C, member 7); ABCC7, CF, cystic fibrosis transmembrane conductance regulator, ATP binding cassette (sub family C, member 7); cystic fibrosis transmembrane conductance regulator; ABC35; ATP binding cassette sub family C; member 7; CFTR/MRP; dJ760C5.1; MRP7; TNR CFTR; cAMP-dependent chloride channel; channel conductance-controlling ATPase; ATP-binding cassette sub-family C member 7; ATP-binding cassette transporter sub-family C member 7; CF; ABCC7; TNR-CFTR;
Gene ID 1080
mRNA Refseq NM_000492
Protein Refseq NP_000483
MIM 602421
UniProt ID P13569
Chromosome Location 7q31-q32
Pathway ABC transporters, organism-specific biosystem; ABC transporters, conserved biosystem; ABC-family proteins mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem;
Function ATP binding; ATP-binding and phosphorylation-dependent chloride channel activity; ATPase activity; PDZ domain binding; channel-conductance-controlling ATPase activity; chloride channel activity; enzyme binding; hydrolase activity; ion channel activity; nucleotide binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CFTR Products

Required fields are marked with *

My Review for All CFTR Products

Required fields are marked with *

0
cart-icon