Recombinant Human CGREF1, His-tagged
Cat.No. : | CGREF1-66H |
Product Overview : | Recombinant Human Cell Growth Regulator with EF Hand Domain Protein 1/CGREF1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala20-Ile301) of Human CGREF1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-301 a.a. |
Description : | Cell Growth Regulator with EF Hand Domain Protein 1 (CGREF1) is a secreted calcium ion binding protein. CGREF1 contains two EF-hand domains and both EF-hands are required for function. Human CGREF1 is synthesized as a 301 amino acid precursor that contains a 19 amino acid signal sequence, and a 282 amino acid mature chain. CGREF1 is probably digested extracellularly by an unknown serine protease generating extremely hydrophobic bioactive peptides. CGREF1 mediates cell-cell adhesion in a calcium-dependent manner. In addition, CGREF1 is able to inhibit growth in several cell lines. |
AA Sequence : | APKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYD QSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRH VEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGGQAEA DGDVPGPRGEAEGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGET LESKNTQNDFEVHIVQVENDEIVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CGREF1 cell growth regulator with EF-hand domain 1 [ Homo sapiens ] |
Official Symbol | CGREF1 |
Synonyms | CGREF1; cell growth regulator with EF-hand domain 1; cell growth regulator with EF hand domain protein 1; CGR11; hydrophobestin; cell growth regulatory gene 11 protein; cell growth regulator with EF hand domain 1; |
Gene ID | 10669 |
mRNA Refseq | NM_001166239 |
Protein Refseq | NP_001159711 |
MIM | 606137 |
UniProt ID | Q99674 |
Chromosome Location | 2p23.3 |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
CGREF1-2915H | Recombinant Human CGREF1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cgref1-2133M | Recombinant Mouse Cgref1 Protein, Myc/DDK-tagged | +Inquiry |
CGREF1-1193H | Recombinant Human CGREF1 Protein, GST-Tagged | +Inquiry |
CGREF1-1016R | Recombinant Rat CGREF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CGREF1-5268H | Recombinant Human CGREF1 Protein, Strep-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CGREF1-792HCL | Recombinant Human CGREF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CGREF1 Products
Required fields are marked with *
My Review for All CGREF1 Products
Required fields are marked with *