Recombinant Human CGREF1, His-tagged

Cat.No. : CGREF1-66H
Product Overview : Recombinant Human Cell Growth Regulator with EF Hand Domain Protein 1/CGREF1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala20-Ile301) of Human CGREF1 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 20-301 a.a.
Description : Cell Growth Regulator with EF Hand Domain Protein 1 (CGREF1) is a secreted calcium ion binding protein. CGREF1 contains two EF-hand domains and both EF-hands are required for function. Human CGREF1 is synthesized as a 301 amino acid precursor that contains a 19 amino acid signal sequence, and a 282 amino acid mature chain. CGREF1 is probably digested extracellularly by an unknown serine protease generating extremely hydrophobic bioactive peptides. CGREF1 mediates cell-cell adhesion in a calcium-dependent manner. In addition, CGREF1 is able to inhibit growth in several cell lines.
AA Sequence : APKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYD QSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRH VEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGGQAEA DGDVPGPRGEAEGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGET LESKNTQNDFEVHIVQVENDEIVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name CGREF1 cell growth regulator with EF-hand domain 1 [ Homo sapiens ]
Official Symbol CGREF1
Synonyms CGREF1; cell growth regulator with EF-hand domain 1; cell growth regulator with EF hand domain protein 1; CGR11; hydrophobestin; cell growth regulatory gene 11 protein; cell growth regulator with EF hand domain 1;
Gene ID 10669
mRNA Refseq NM_001166239
Protein Refseq NP_001159711
MIM 606137
UniProt ID Q99674
Chromosome Location 2p23.3
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CGREF1 Products

Required fields are marked with *

My Review for All CGREF1 Products

Required fields are marked with *

0
cart-icon
0
compare icon