Recombinant Human CGREF1, His-tagged

• Cat.No.: CGREF1-66H
• Product Overview: Recombinant Human Cell Growth Regulator with EF Hand Domain Protein 1/CGREF1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala20-Ile301) of Human CGREF1 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 20-301 a.a.
• Description: Cell Growth Regulator with EF Hand Domain Protein 1 (CGREF1) is a secreted calcium ion binding protein. CGREF1 contains two EF-hand domains and both EF-hands are required for function. Human CGREF1 is synthesized as a 301 amino acid precursor that contains a 19 amino acid signal sequence, and a 282 amino acid mature chain. CGREF1 is probably digested extracellularly by an unknown serine protease generating extremely hydrophobic bioactive peptides. CGREF1 mediates cell-cell adhesion in a calcium-dependent manner. In addition, CGREF1 is able to inhibit growth in several cell lines.
• AA Sequence: APKDGVTRPDSEVQHQLLPNPFQPGQEQLGLLQSYLKGLGRTEVQLEHLSREQVLLYLFALHDYD QSGQLDGLELLSMLTAALAPGAANSPTTNPVILIVDKVLETQDLNGDGLMTPAELINFPGVALRH VEPGEPLAPSPQEPQAVGRQSLLAKSPLRQETQEAPGPREEAKGQVEARRESLDPVQEPGGQAEA DGDVPGPRGEAEGQAEAKGDAPGPRGEAGGQAEAEGDAPGPRGEAGGQAEARENGEEAKELPGET LESKNTQNDFEVHIVQVENDEIVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: CGREF1 cell growth regulator with EF-hand domain 1 [ Homo sapiens ]
• Official Symbol: CGREF1
• Synonyms: CGREF1; cell growth regulator with EF-hand domain 1; cell growth regulator with EF hand domain protein 1; CGR11; hydrophobestin; cell growth regulatory gene 11 protein; cell growth regulator with EF hand domain 1
• Gene ID: 10669
• mRNA Refseq: NM_001166239
• Protein Refseq: NP_001159711
• MIM: 606137
• UniProt ID: Q99674
• Chromosome Location: 2p23.3
• Function: calcium ion binding