Recombinant Human CHAC1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CHAC1-5990H | 
| Product Overview : | CHAC1 MS Standard C13 and N15-labeled recombinant protein (NP_077016) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | This gene encodes a member of the gamma-glutamylcyclotransferase family of proteins. The encoded protein has been shown to promote neuronal differentiation by deglycination of the Notch receptor, which prevents receptor maturation and inhibits Notch signaling. This protein may also play a role in the unfolded protein response, and in regulation of glutathione levels and oxidative balance in the cell. Elevated expression of this gene may indicate increased risk of cancer recurrence among breast and ovarian cancer patients. | 
| Molecular Mass : | 24.4 kDa | 
| AA Sequence : | MKQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALVTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | CHAC1 ChaC glutathione specific gamma-glutamylcyclotransferase 1 [ Homo sapiens (human) ] | 
| Official Symbol | CHAC1 | 
| Synonyms | CHAC1; ChaC glutathione specific gamma-glutamylcyclotransferase 1; glutathione-specific gamma-glutamylcyclotransferase 1; ChaC, cation transport regulator homolog 1; ChaC, cation transport regulator-like 1; blocks Notch protein; botch; gamma-GCG 1; gamma-GCT acting on glutathione homolog 1; EC 4.3.2.7 | 
| Gene ID | 79094 | 
| mRNA Refseq | NM_024111 | 
| Protein Refseq | NP_077016 | 
| MIM | 614587 | 
| UniProt ID | Q9BUX1 | 
| ◆ Recombinant Proteins | ||
| CHAC1-431HFL | Recombinant Full Length Human CHAC1 Protein, C-Flag-tagged | +Inquiry | 
| CHAC1-3362M | Recombinant Mouse CHAC1 Protein | +Inquiry | 
| CHAC1-5990H | Recombinant Human CHAC1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CHAC1-0222H | Recombinant Human CHAC1 Protein (K2-V222), Tag Free | +Inquiry | 
| CHAC1-0223H | Recombinant Human CHAC1 Protein (K2-V222), His/Strep tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAC1 Products
Required fields are marked with *
My Review for All CHAC1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            