Recombinant Human CHAD, His-tagged

Cat.No. : CHAD-67H
Product Overview : Recombinant Human Chondroadherin/CHAD is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Cys23-His359) of Human CHAD fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 23-359 a.a.
Description : Chondroadherin is a secreted protein that belongs to the small leucine-rich proteoglycan (SLRP) family of SLRP class IV subfamily. Chondroadherin contains one LRRCT domain, one LRRNT domain, and nine LRR (leucine-rich) repeats. It presents in chondrocytes at all ages. Chondroadherin is initially found as a 36-kD matrix protein isolated from bovine cartilage. It is shown to mediate chondrocyte-matrix interactions. Chondroadherin promotes attachment of chondrocytes, fibroblasts, and osteoblasts. This binding is mediated (at least for chondrocytes and fibroblasts) by the integrin α2β1. Chondroadherin may play an important role in the regulation of chondrocyte growth and proliferation.
AA Sequence : CPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQI REVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFIL QLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSK LRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQ LPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCK FPTKRSKKAGRHVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name CHAD chondroadherin [ Homo sapiens ]
Official Symbol CHAD
Synonyms CHAD; chondroadherin; chondroadherin proteoglycan; SLRR4A; cartilage leucine-rich protein;
Gene ID 1101
mRNA Refseq NM_001267
Protein Refseq NP_001258
MIM 602178
UniProt ID O15335
Chromosome Location 17q21.33
Pathway ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function extracellular matrix structural constituent;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHAD Products

Required fields are marked with *

My Review for All CHAD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon