Recombinant Human CHAD, His-tagged
Cat.No. : | CHAD-67H |
Product Overview : | Recombinant Human Chondroadherin/CHAD is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Cys23-His359) of Human CHAD fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 23-359 a.a. |
Description : | Chondroadherin is a secreted protein that belongs to the small leucine-rich proteoglycan (SLRP) family of SLRP class IV subfamily. Chondroadherin contains one LRRCT domain, one LRRNT domain, and nine LRR (leucine-rich) repeats. It presents in chondrocytes at all ages. Chondroadherin is initially found as a 36-kD matrix protein isolated from bovine cartilage. It is shown to mediate chondrocyte-matrix interactions. Chondroadherin promotes attachment of chondrocytes, fibroblasts, and osteoblasts. This binding is mediated (at least for chondrocytes and fibroblasts) by the integrin α2β1. Chondroadherin may play an important role in the regulation of chondrocyte growth and proliferation. |
AA Sequence : | CPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQI REVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFIL QLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSK LRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQ LPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCK FPTKRSKKAGRHVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CHAD chondroadherin [ Homo sapiens ] |
Official Symbol | CHAD |
Synonyms | CHAD; chondroadherin; chondroadherin proteoglycan; SLRR4A; cartilage leucine-rich protein; |
Gene ID | 1101 |
mRNA Refseq | NM_001267 |
Protein Refseq | NP_001258 |
MIM | 602178 |
UniProt ID | O15335 |
Chromosome Location | 17q21.33 |
Pathway | ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | extracellular matrix structural constituent; |
◆ Recombinant Proteins | ||
CHAD-1706H | Recombinant Human CHAD Protein (Cys23-His359), C-His tagged | +Inquiry |
CHAD-1363R | Recombinant Rat CHAD Protein | +Inquiry |
CHAD-11290Z | Recombinant Zebrafish CHAD | +Inquiry |
CHAD-1621M | Recombinant Mouse CHAD Protein, His (Fc)-Avi-tagged | +Inquiry |
CHAD-1201H | Recombinant Human CHAD Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHAD-182HCL | Recombinant Human CHAD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAD Products
Required fields are marked with *
My Review for All CHAD Products
Required fields are marked with *