Recombinant Human CHAD protein, T7/His-tagged
Cat.No. : | CHAD-49H |
Product Overview : | Recombinant mature form of human CHAD gene cDNA (23 - 359aa, derived from BC036360) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 23-359 a.a. |
Form : | 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFCPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAA NSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLL SPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKL RVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLE TLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro CHAD mediated chondrocytes differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CHAD protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As native (non-glycosilated) antigen for specific antibody production. |
Storage : | Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CHAD chondroadherin [ Homo sapiens ] |
Official Symbol | CHAD |
Synonyms | CHAD; chondroadherin; chondroadherin proteoglycan; SLRR4A; cartilage leucine-rich protein; |
Gene ID | 1101 |
mRNA Refseq | NM_001267 |
Protein Refseq | NP_001258 |
MIM | 602178 |
UniProt ID | O15335 |
Chromosome Location | 17q21.33 |
Pathway | ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; |
Function | extracellular matrix structural constituent; |
◆ Recombinant Proteins | ||
CHAD-1363R | Recombinant Rat CHAD Protein | +Inquiry |
CHAD-1201H | Recombinant Human CHAD Protein, GST-Tagged | +Inquiry |
CHAD-67H | Recombinant Human CHAD, His-tagged | +Inquiry |
CHAD-49H | Recombinant Human CHAD protein, T7/His-tagged | +Inquiry |
CHAD-1621M | Recombinant Mouse CHAD Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHAD-182HCL | Recombinant Human CHAD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHAD Products
Required fields are marked with *
My Review for All CHAD Products
Required fields are marked with *