Recombinant Human CHAD protein, T7/His-tagged

Cat.No. : CHAD-49H
Product Overview : Recombinant mature form of human CHAD gene cDNA (23 - 359aa, derived from BC036360) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 23-359 a.a.
Form : 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGGEFCPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAA NSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLL SPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKL RVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLE TLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro CHAD mediated chondrocytes differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CHAD protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As native (non-glycosilated) antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name CHAD chondroadherin [ Homo sapiens ]
Official Symbol CHAD
Synonyms CHAD; chondroadherin; chondroadherin proteoglycan; SLRR4A; cartilage leucine-rich protein;
Gene ID 1101
mRNA Refseq NM_001267
Protein Refseq NP_001258
MIM 602178
UniProt ID O15335
Chromosome Location 17q21.33
Pathway ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function extracellular matrix structural constituent;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHAD Products

Required fields are marked with *

My Review for All CHAD Products

Required fields are marked with *

0
cart-icon
0
compare icon