Recombinant Human CHMP1B protein, His-tagged
| Cat.No. : | CHMP1B-6794H | 
| Product Overview : | Recombinant Human CHMP1B protein(1-199 aa), fused with N-terminal His tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-199 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AASequence : | MSNMEKHLFNLKFAAKELSRSAKKCDKEEKAEKAKIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVTMGKVTKSMAGVVKSMDATLKTMNLEKISALMDKFEHQFETLDVQTQQMEDTMSSTTTLTTPQNQVDMLLQEMADEAGLDLNMELPQGQTGSVGTSVASAEQDELSQRLARLRDQV | 
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | CHMP1B charged multivesicular body protein 1B [ Homo sapiens ] | 
| Official Symbol | CHMP1B | 
| Synonyms | CHMP1B; charged multivesicular body protein 1B; chromatin modifying protein 1B; charged multivesicular body protein 1b; C18orf2; CHMP1.5; Vps46B; vacuolar protein sorting 46-2; chromatin-modifying protein 1b; vacuolar protein sorting-associated protein 46-2; C10orf2; Vps46-2; C18-ORF2; hVps46-2; | 
| Gene ID | 57132 | 
| mRNA Refseq | NM_020412 | 
| Protein Refseq | NP_065145 | 
| MIM | 606486 | 
| UniProt ID | Q7LBR1 | 
| ◆ Recombinant Proteins | ||
| CHMP1B-11183H | Recombinant Human CHMP1B protein, GST-tagged | +Inquiry | 
| CHMP1B-3204HF | Recombinant Full Length Human CHMP1B Protein, GST-tagged | +Inquiry | 
| CHMP1B-848R | Recombinant Rhesus monkey CHMP1B Protein, His-tagged | +Inquiry | 
| CHMP1B-674R | Recombinant Rhesus Macaque CHMP1B Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CHMP1B-1247H | Recombinant Human CHMP1B Protein, GST-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CHMP1B-7533HCL | Recombinant Human CHMP1B 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHMP1B Products
Required fields are marked with *
My Review for All CHMP1B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            