Recombinant Human CHCHD1 Protein, GST-Tagged
| Cat.No. : | CHCHD1-1206H |
| Product Overview : | Human CHCHD1 full-length ORF (AAH15387.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1) is a Protein Coding gene. Among its related pathways are Mitochondrial translation and Organelle biogenesis and maintenance. GO annotations related to this gene include poly(A) RNA binding. |
| Molecular Mass : | 39.38 kDa |
| AA Sequence : | MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHCHD1 coiled-coil-helix-coiled-coil-helix domain containing 1 [ Homo sapiens ] |
| Official Symbol | CHCHD1 |
| Synonyms | CHCHD1; coiled-coil-helix-coiled-coil-helix domain containing 1; C10orf34, chromosome 10 open reading frame 34; coiled-coil-helix-coiled-coil-helix domain-containing protein 1; FLJ25854; nuclear protein C2360; C2360; C10orf34; |
| Gene ID | 118487 |
| mRNA Refseq | NM_203298 |
| Protein Refseq | NP_976043 |
| MIM | 608842 |
| UniProt ID | Q96BP2 |
| ◆ Recombinant Proteins | ||
| CHCHD1-836R | Recombinant Rhesus monkey CHCHD1 Protein, His-tagged | +Inquiry |
| CHCHD1-662R | Recombinant Rhesus Macaque CHCHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHCHD1-5221Z | Recombinant Zebrafish CHCHD1 | +Inquiry |
| CHCHD1-1624M | Recombinant Mouse CHCHD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHCHD1-1206H | Recombinant Human CHCHD1 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHCHD1-7546HCL | Recombinant Human CHCHD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHCHD1 Products
Required fields are marked with *
My Review for All CHCHD1 Products
Required fields are marked with *
