Recombinant Human CHCHD1 Protein, GST-Tagged

Cat.No. : CHCHD1-1206H
Product Overview : Human CHCHD1 full-length ORF (AAH15387.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1) is a Protein Coding gene. Among its related pathways are Mitochondrial translation and Organelle biogenesis and maintenance. GO annotations related to this gene include poly(A) RNA binding.
Molecular Mass : 39.38 kDa
AA Sequence : MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMSVMMACWKQNEFRDDACRKEIQGFLDCAARAQEARKMRSIQETLGESGSLLPNKLNKLLQRFPNKPYLS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHCHD1 coiled-coil-helix-coiled-coil-helix domain containing 1 [ Homo sapiens ]
Official Symbol CHCHD1
Synonyms CHCHD1; coiled-coil-helix-coiled-coil-helix domain containing 1; C10orf34, chromosome 10 open reading frame 34; coiled-coil-helix-coiled-coil-helix domain-containing protein 1; FLJ25854; nuclear protein C2360; C2360; C10orf34;
Gene ID 118487
mRNA Refseq NM_203298
Protein Refseq NP_976043
MIM 608842
UniProt ID Q96BP2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHCHD1 Products

Required fields are marked with *

My Review for All CHCHD1 Products

Required fields are marked with *

0
cart-icon
0
compare icon