Recombinant Human CHD3 Protein, GST-Tagged
| Cat.No. : | CHD3-1214H |
| Product Overview : | Human CHD3 partial ORF (NP_001005273, 1654 a.a. - 1741 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 35.42 kDa |
| AA Sequence : | KPLDGQEHRERPEGETGDLGKREDVKGDRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHD3 chromodomain helicase DNA binding protein 3 [ Homo sapiens ] |
| Official Symbol | CHD3 |
| Synonyms | CHD3; chromodomain helicase DNA binding protein 3; chromodomain-helicase-DNA-binding protein 3; Mi 2a; Mi2 ALPHA; ZFH; hZFH; CHD-3; zinc finger helicase; ATP-dependent helicase CHD3; mi-2 autoantigen 240 kDa protein; zinc-finger helicase (Snf2-like); Mi-2a; Mi2-ALPHA; |
| Gene ID | 1107 |
| mRNA Refseq | NM_001005271 |
| Protein Refseq | NP_001005271 |
| MIM | 602120 |
| UniProt ID | Q12873 |
| ◆ Recombinant Proteins | ||
| CHD3-1214H | Recombinant Human CHD3 Protein, GST-Tagged | +Inquiry |
| Chd3-451M | Recombinant Mouse Chd3 Protein, His-tagged | +Inquiry |
| CHD3-450H | Recombinant Human CHD3 Protein, His-tagged | +Inquiry |
| CHD3-1011H | Recombinant Human CHD3 Protein (Cys382-Phe573), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHD3-108HKCL | Human CHD3 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHD3 Products
Required fields are marked with *
My Review for All CHD3 Products
Required fields are marked with *
