Recombinant Human CHGA protein, GST-tagged
Cat.No. : | CHGA-2692H |
Product Overview : | Recombinant Human CHGA protein(P10645)(224-457aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 224-457aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.4 kDa |
AA Sequence : | QAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CHGA chromogranin A (parathyroid secretory protein 1) [ Homo sapiens ] |
Official Symbol | CHGA |
Synonyms | CHGA; chromogranin A (parathyroid secretory protein 1); chromogranin-A; pancreastatin; parastatin; vasostatin; SP-I; pituitary secretory protein I; parathyroid secretory protein 1; betagranin (N-terminal fragment of chromogranin A); CGA; |
Gene ID | 1113 |
mRNA Refseq | NM_001275 |
Protein Refseq | NP_001266 |
MIM | 118910 |
UniProt ID | P10645 |
◆ Recombinant Proteins | ||
Chga-5814M | Recombinant Mouse Chga protein, His & T7-tagged | +Inquiry |
CHGA-1544H | Recombinant Human CHGA Protein (Met158-Gly457), N-His tagged | +Inquiry |
CHGA-2692H | Recombinant Human CHGA protein, GST-tagged | +Inquiry |
CHGA-26904TH | Recombinant Human CHGA, His-tagged | +Inquiry |
CHGA-2629H | Recombinant Human CHGA protein(331-450 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHGA-7540HCL | Recombinant Human CHGA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHGA Products
Required fields are marked with *
My Review for All CHGA Products
Required fields are marked with *
0
Inquiry Basket