Recombinant Human CHGA protein, His-tagged
Cat.No. : | CHGA-2740H |
Product Overview : | Recombinant Human CHGA protein(19-225aa), fused to His tag, was expressed in E. coli. |
Availability | August 03, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-225aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LPVNSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAVEEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQA |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CHGA chromogranin A (parathyroid secretory protein 1) [ Homo sapiens ] |
Official Symbol | CHGA |
Synonyms | CHGA; chromogranin A (parathyroid secretory protein 1); chromogranin-A; pancreastatin; parastatin; vasostatin; SP-I; pituitary secretory protein I; parathyroid secretory protein 1; betagranin (N-terminal fragment of chromogranin A); CGA; |
Gene ID | 1113 |
mRNA Refseq | NM_001275 |
Protein Refseq | NP_001266 |
MIM | 118910 |
UniProt ID | P10645 |
◆ Recombinant Proteins | ||
CHGA-1544H | Recombinant Human CHGA Protein (Met158-Gly457), N-His tagged | +Inquiry |
CHGA-403H | Recombinant Human Chromogranin A | +Inquiry |
CHGA-26907TH | Recombinant Human CHGA | +Inquiry |
CHGA-2740H | Recombinant Human CHGA protein, His-tagged | +Inquiry |
CHGA-412H | Recombinant Human CHGA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHGA-7540HCL | Recombinant Human CHGA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHGA Products
Required fields are marked with *
My Review for All CHGA Products
Required fields are marked with *