Recombinant Human CHI3L2, His-tagged

• Cat.No.: CHI3L2-7759H
• Product Overview: Recombinant Human Chitinase 3-Like Protein 2/CHI3L2 is produced with our mammalian expression system in human cells. The target protein is expressed with sequence (Tyr27-Leu390) of Human CHI3L2 fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 27-390 a.a.
• Description: The protein encoded by this gene is similar to bacterial chitinases but lacks chitinase activity. The encoded protein is secreted and is involved in cartilage biogenesis. Several transcript variants encoding different isoforms have been found for this gene.
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
• AA Sequence: YKLVCYFTNWSQDRQEPGKFTPENIDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTK NPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFT VLIHELAEAFQKDFTKSTKERLLLTVGVSAGRQMIDNSYQVEKLAKDLDFINLLSFDFHGSWEKP LITGHNSPLSKGWQDRGPSSYYNVEYAVGYWIHKGMPSEKVVMGIPTYGHSFTLASAETTVGAPA SGPGAAGPITESSGFLAYYEICQFLKGAKITRLQDQQVPYAVKGNQWVGYDDVKSMETKVQFLKN LNLGGAMIWSIDMDDFTGKSCNQGPYPLVQAVKRSLGSLVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at< -20°c,="" though="" stable="" at="" room="" temperature="" for="" 3="">Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at< -20°c="" for="" 3="">
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 ug/ml.Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: CHI3L2?chitinase 3-like 2 [?Homo sapiens?(human) ]
• Official Symbol: CHI3L2
• Synonyms: CHI3L2; CHIL2; YKL39; YKL-39; chitinase 3-like 2; chitinase-3-like protein 2; chondrocyte protein 39
• Gene ID: 1117
• mRNA Refseq: NM_004000
• Protein Refseq: NP_003991
• MIM: 601526
• UniProt ID: Q15782
• Chromosome Location: 1p13.3
• Function: chitin binding; NOT chitinase activity