Recombinant Human CHIC2 protein, His-tagged
| Cat.No. : | CHIC2-5177H |
| Product Overview : | Recombinant Human CHIC2 protein(1-165 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-165 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CHIC2 cysteine-rich hydrophobic domain 2 [ Homo sapiens ] |
| Official Symbol | CHIC2 |
| Synonyms | CHIC2; cysteine-rich hydrophobic domain 2; cysteine-rich hydrophobic domain 2 protein; BTL; BRX-like translocated in leukemia; cystein-rich hydrophobic domain 2; MGC21173; |
| Gene ID | 26511 |
| mRNA Refseq | NM_012110 |
| Protein Refseq | NP_036242 |
| MIM | 604332 |
| UniProt ID | Q9UKJ5 |
| ◆ Recombinant Proteins | ||
| CHIC2-671R | Recombinant Rhesus Macaque CHIC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHIC2-11342Z | Recombinant Zebrafish CHIC2 | +Inquiry |
| CHIC2-1642M | Recombinant Mouse CHIC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Chic2-2143M | Recombinant Mouse Chic2 Protein, Myc/DDK-tagged | +Inquiry |
| CHIC2-11176H | Recombinant Human CHIC2 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHIC2-7537HCL | Recombinant Human CHIC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHIC2 Products
Required fields are marked with *
My Review for All CHIC2 Products
Required fields are marked with *
