Recombinant Human Chorionic Somatomammotropin Hormone 1 (placental lactogen)

Cat.No. : CSH1-346H
Product Overview : Recombinant human CSH1 expressed by E. coli is a 22.3 kDa homodimeric protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : CSH1 is a polypeptide placental hormone. Its structure and function is similar to that of growth hormone. It modifies the metabolic state of the mother during pregnancy to facilitate the energy supply of the fetus. Recombinant human placental lactogen is a 22.3 kDa protein protein sequence.
Biological Activity : Test in process
Molecular Weight : 22.3 kDa
Form : Sterile filtered and lyophilized with no additives.
Endotoxin Level : <0.1 ng/μg
Appearance : Lyophilized protein
Sequence : MVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPT PSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEG IQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRTV QCRSVEGSCGF
Purity : >95% by SDS-PAGE and >95% by HPLC
Reconstitution : Reconstitute in water to a concentration of 0.1-1.0 mg/ml. This solution can then be diluted into other aqueous buffers.
Storage : The lyophilized Placental Lactogen is best-stored desiccated below 0°C. Reconstituted protein should be stored at working aliquots at -20°C. For long-term storage, it is recommended to add carrier protein (0.1% BSA).
Gene Name CSH1 chorionic somatomammotropin hormone 1 (placental lactogen) [ Homo sapiens ]
Official Symbol CSH1
Synonyms CSH1; chorionic somatomammotropin hormone 1 (placental lactogen); PL; CSA; CS-1; CSMT; hCS-A; FLJ75407; chorionic somatomammotropin hormone; Choriomammotropin; placental lactogen; chorionic somatomammotropin A
Gene ID 1442
mRNA Refseq NM_001317
Protein Refseq NP_001308
MIM 150200
UniProt ID P01243
Chromosome Location 17q22-q24
Pathway Jak-STAT signaling pathway; Neuroactive ligand-receptor interaction
Function hormone activity; metal ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CSH1 Products

Required fields are marked with *

My Review for All CSH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon