Recombinant Human CHRNA1
| Cat.No. : | CHRNA1-30388TH |
| Product Overview : | Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 1 with N terminal proprietary tag, 35.09kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 86 amino acids |
| Description : | The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Molecular Weight : | 35.090kDa inclusive of tags |
| Tissue specificity : | Isoform 1 is only expressed in skeletal muscle. Isoform 2 is constitutively expressed in skeletal muscle, brain, heart, kidney, liver, lung and thymus. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP |
| Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-1/CHRNA1 sub-subfamily. |
| Gene Name | CHRNA1 cholinergic receptor, nicotinic, alpha 1 (muscle) [ Homo sapiens ] |
| Official Symbol | CHRNA1 |
| Synonyms | CHRNA1; cholinergic receptor, nicotinic, alpha 1 (muscle); cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) , CHRNA; acetylcholine receptor subunit alpha; |
| Gene ID | 1134 |
| mRNA Refseq | NM_000079 |
| Protein Refseq | NP_000070 |
| MIM | 100690 |
| Uniprot ID | P02708 |
| Chromosome Location | 2q24-q32 |
| Pathway | Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Effects of Botulinum toxin, organism-specific biosystem; ErbB2/ErbB3 signaling events, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; |
| Function | contributes_to acetylcholine binding; contributes_to acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; contributes_to acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion chann; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA1 Products
Required fields are marked with *
My Review for All CHRNA1 Products
Required fields are marked with *
