Recombinant Human CHRNA10 protein, GST-tagged
Cat.No. : | CHRNA10-5343H |
Product Overview : | Recombinant Human CHRNA10 protein(Q9GZZ6)(25-240aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 25-240aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.0 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV |
Gene Name | CHRNA10 cholinergic receptor, nicotinic, alpha 10 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNA10 |
Synonyms | CHRNA10; cholinergic receptor, nicotinic, alpha 10 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 10; neuronal acetylcholine receptor subunit alpha-10; acetylcholine receptor; nicotinic; alpha 10 (neuronal); NACHR alpha-10; nicotinic acetylcholine receptor subunit alpha-10; acetylcholine receptor, nicotinic, alpha 10 (neuronal); |
Gene ID | 57053 |
mRNA Refseq | NM_020402 |
Protein Refseq | NP_065135 |
MIM | 606372 |
UniProt ID | Q9GZZ6 |
◆ Recombinant Proteins | ||
CHRNA10-779H | Recombinant Human CHRNA10 Protein, His-tagged | +Inquiry |
CHRNA10-5343H | Recombinant Human CHRNA10 protein, GST-tagged | +Inquiry |
Chrna10-7894R | Recombinant Rat Chrna10 protein, His & T7-tagged | +Inquiry |
CHRNA10-1390R | Recombinant Rat CHRNA10 Protein | +Inquiry |
CHRNA10-3734C | Recombinant Chicken CHRNA10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRNA10-7516HCL | Recombinant Human CHRNA10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNA10 Products
Required fields are marked with *
My Review for All CHRNA10 Products
Required fields are marked with *
0
Inquiry Basket