Recombinant Human CHRNA10 protein, GST-tagged

Cat.No. : CHRNA10-5343H
Product Overview : Recombinant Human CHRNA10 protein(Q9GZZ6)(25-240aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 25-240aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 51.0 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : AEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYV
Gene Name CHRNA10 cholinergic receptor, nicotinic, alpha 10 (neuronal) [ Homo sapiens ]
Official Symbol CHRNA10
Synonyms CHRNA10; cholinergic receptor, nicotinic, alpha 10 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 10; neuronal acetylcholine receptor subunit alpha-10; acetylcholine receptor; nicotinic; alpha 10 (neuronal); NACHR alpha-10; nicotinic acetylcholine receptor subunit alpha-10; acetylcholine receptor, nicotinic, alpha 10 (neuronal);
Gene ID 57053
mRNA Refseq NM_020402
Protein Refseq NP_065135
MIM 606372
UniProt ID Q9GZZ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA10 Products

Required fields are marked with *

My Review for All CHRNA10 Products

Required fields are marked with *

0
cart-icon
0
compare icon