Recombinant Human CHRNA2
Cat.No. : | CHRNA2-30387TH |
Product Overview : | Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 2 with N-terminal proprietary tag. Predicted MW 37.73kDa. |
- Specification
- Gene Information
- Related Products
Description : | Nicotinic acetylcholine receptors (nAChRs) are ligand-gated ion channels formed by a pentameric arrangement of alpha and beta subunits to create distinct muscle and neuronal receptors. Neuronal receptors are found throughout the peripheral and central nervous system where they are involved in fast synaptic transmission. This gene encodes an alpha subunit that is widely expressed in the brain. The proposed structure for nAChR subunits is a conserved N-terminal extracellular domain followed by three conserved transmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminal extracellular region. Mutations in this gene cause autosomal dominant nocturnal frontal lobe epilepsy type 4. Single nucleotide polymorphisms (SNPs) in this gene have been associated with nicotine dependence. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EEAKRPPPRAPGDPLSSPSPTALPQGGSHTETEDRLFKHL FRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMT TNVWLKQEWSDYKLRWNPADFGNITSLRVP |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-2/CHRNA2 sub-subfamily. |
Gene Name : | CHRNA2 cholinergic receptor, nicotinic, alpha 2 (neuronal) [ Homo sapiens ] |
Official Symbol : | CHRNA2 |
Synonyms : | CHRNA2; cholinergic receptor, nicotinic, alpha 2 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal); neuronal acetylcholine receptor subunit alpha-2; |
Gene ID : | 1135 |
mRNA Refseq : | NM_000742 |
Protein Refseq : | NP_000733 |
MIM : | 118502 |
Uniprot ID : | Q15822 |
Chromosome Location : | 8p21 |
Pathway : | Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; |
Function : | acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity; |
Products Types
◆ Recombinant Protein | ||
CHRNA2-1663M | Recombinant Mouse CHRNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA2-1279H | Recombinant Human CHRNA2 Protein, GST-Tagged | +Inquiry |
Chrna2-488M | Recombinant Mouse Chrna2 Protein, MYC/DDK-tagged | +Inquiry |
CHRNA2-3231H | Recombinant Human CHRNA2 Protein, MYC/DDK-tagged | +Inquiry |
CHRNA2-1049R | Recombinant Rat CHRNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket