Recombinant Human CHRNA3 Protein (32-240 aa), His-tagged

Cat.No. : CHRNA3-2691H
Product Overview : Recombinant Human CHRNA3 Protein (32-240 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 32-240 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 26.0 kDa
AA Sequence : SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name CHRNA3 cholinergic receptor, nicotinic, alpha 3 (neuronal) [ Homo sapiens ]
Official Symbol CHRNA3
Synonyms CHRNA3; acetylcholine receptor; nicotinic; alpha 3 (neuronal); LNCR2; PAOD2; NACHRA3; MGC104879;
Gene ID 1136
mRNA Refseq NM_000743
Protein Refseq NP_000734
MIM 118503
UniProt ID P32297

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA3 Products

Required fields are marked with *

My Review for All CHRNA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon