Recombinant Human CHRNA3 Protein (32-240 aa), His-tagged
| Cat.No. : | CHRNA3-2691H |
| Product Overview : | Recombinant Human CHRNA3 Protein (32-240 aa) is produced by Yeast expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 32-240 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 26.0 kDa |
| AA Sequence : | SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | CHRNA3 cholinergic receptor, nicotinic, alpha 3 (neuronal) [ Homo sapiens ] |
| Official Symbol | CHRNA3 |
| Synonyms | CHRNA3; acetylcholine receptor; nicotinic; alpha 3 (neuronal); LNCR2; PAOD2; NACHRA3; MGC104879; |
| Gene ID | 1136 |
| mRNA Refseq | NM_000743 |
| Protein Refseq | NP_000734 |
| MIM | 118503 |
| UniProt ID | P32297 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA3 Products
Required fields are marked with *
My Review for All CHRNA3 Products
Required fields are marked with *



