Recombinant Human CHRNA5

Cat.No. : CHRNA5-30389TH
Product Overview : Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 5 with a N terminal proprietary tag: predicted molecular weight 35.97 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 94 amino acids
Description : The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).
Molecular Weight : 35.970kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
Sequence Similarities : Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-5/CHRNA5 sub-subfamily.
Gene Name CHRNA5 cholinergic receptor, nicotinic, alpha 5 [ Homo sapiens ]
Official Symbol CHRNA5
Synonyms CHRNA5; cholinergic receptor, nicotinic, alpha 5; cholinergic receptor, nicotinic, alpha polypeptide 5; neuronal acetylcholine receptor subunit alpha-5;
Gene ID 1138
mRNA Refseq NM_000745
Protein Refseq NP_000736
MIM 118505
Uniprot ID P30532
Chromosome Location 15q24
Pathway Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function acetylcholine binding; acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA5 Products

Required fields are marked with *

My Review for All CHRNA5 Products

Required fields are marked with *

0
cart-icon