Recombinant Human CHRNA5
Cat.No. : | CHRNA5-30389TH |
Product Overview : | Recombinant fragment of Human Nicotinic Acetylcholine Receptor alpha 5 with a N terminal proprietary tag: predicted molecular weight 35.97 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 94 amino acids |
Description : | The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2). |
Molecular Weight : | 35.970kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP |
Sequence Similarities : | Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily. Alpha-5/CHRNA5 sub-subfamily. |
Gene Name | CHRNA5 cholinergic receptor, nicotinic, alpha 5 [ Homo sapiens ] |
Official Symbol | CHRNA5 |
Synonyms | CHRNA5; cholinergic receptor, nicotinic, alpha 5; cholinergic receptor, nicotinic, alpha polypeptide 5; neuronal acetylcholine receptor subunit alpha-5; |
Gene ID | 1138 |
mRNA Refseq | NM_000745 |
Protein Refseq | NP_000736 |
MIM | 118505 |
Uniprot ID | P30532 |
Chromosome Location | 15q24 |
Pathway | Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; |
Function | acetylcholine binding; acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; |
◆ Recombinant Proteins | ||
CHRNA5-2606Z | Recombinant Zebrafish CHRNA5 | +Inquiry |
CHRNA5-11213H | Recombinant Human CHRNA5, GST-tagged | +Inquiry |
RFL26147RF | Recombinant Full Length Rat Neuronal Acetylcholine Receptor Subunit Alpha-5(Chrna5) Protein, His-Tagged | +Inquiry |
CHRNA5-1282H | Recombinant Human CHRNA5 Protein, GST-Tagged | +Inquiry |
RFL4830BF | Recombinant Full Length Bovine Neuronal Acetylcholine Receptor Subunit Alpha-5(Chrna5) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA5 Products
Required fields are marked with *
My Review for All CHRNA5 Products
Required fields are marked with *