Recombinant Human CHRNA5 Protein, GST-Tagged

Cat.No. : CHRNA5-1282H
Product Overview : Human CHRNA5 partial ORF (NP_000736, 38 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).[provided by RefSeq, Jun 2010]
Molecular Mass : 36.08 kDa
AA Sequence : SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHRNA5 cholinergic receptor, nicotinic, alpha 5 (neuronal) [ Homo sapiens ]
Official Symbol CHRNA5
Synonyms CHRNA5; cholinergic receptor, nicotinic, alpha 5 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 5; neuronal acetylcholine receptor subunit alpha-5; acetylcholine receptor; nicotinic; alpha 5 (neuronal); acetylcholine receptor, nicotinic, alpha 5 (neuronal); neuronal nicotinic acetylcholine receptor, alpha5 subunit; Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5; LNCR2;
Gene ID 1138
mRNA Refseq NM_000745
Protein Refseq NP_000736
MIM 118505
UniProt ID P30532

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNA5 Products

Required fields are marked with *

My Review for All CHRNA5 Products

Required fields are marked with *

0
cart-icon
0
compare icon