Recombinant Human CHRNA5 Protein, GST-Tagged
Cat.No. : | CHRNA5-1282H |
Product Overview : | Human CHRNA5 partial ORF (NP_000736, 38 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).[provided by RefSeq, Jun 2010] |
Molecular Mass : | 36.08 kDa |
AA Sequence : | SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRNA5 cholinergic receptor, nicotinic, alpha 5 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNA5 |
Synonyms | CHRNA5; cholinergic receptor, nicotinic, alpha 5 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 5; neuronal acetylcholine receptor subunit alpha-5; acetylcholine receptor; nicotinic; alpha 5 (neuronal); acetylcholine receptor, nicotinic, alpha 5 (neuronal); neuronal nicotinic acetylcholine receptor, alpha5 subunit; Cholinergic receptor, neuronal nicotinic, alpha polypeptide-5; LNCR2; |
Gene ID | 1138 |
mRNA Refseq | NM_000745 |
Protein Refseq | NP_000736 |
MIM | 118505 |
UniProt ID | P30532 |
◆ Recombinant Proteins | ||
CHRNA5-1282H | Recombinant Human CHRNA5 Protein, GST-Tagged | +Inquiry |
CHRNA5-1665M | Recombinant Mouse CHRNA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNA5-5985C | Recombinant Chicken CHRNA5 | +Inquiry |
CHRNA5-3434M | Recombinant Mouse CHRNA5 Protein | +Inquiry |
RFL21348PF | Recombinant Full Length Pan Troglodytes Neuronal Acetylcholine Receptor Subunit Alpha-5(Chrna5) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNA5 Products
Required fields are marked with *
My Review for All CHRNA5 Products
Required fields are marked with *