Recombinant Human CHRNB4 Protein, GST-Tagged
Cat.No. : | CHRNB4-1290H |
Product Overview : | Human CHRNB4 partial ORF (NP_000741, 68 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CHRNB4 (Cholinergic Receptor Nicotinic Beta 4 Subunit) is a Protein Coding gene. Diseases associated with CHRNB4 include Substance Dependence and Nicotine Dependence, Protection Against. Among its related pathways are Innate Immune System and Sudden Infant Death Syndrome (SIDS) Susceptibility Pathways. GO annotations related to this gene include extracellular ligand-gated ion channel activity and ligand-gated ion channel activity. An important paralog of this gene is CHRNB2. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | VNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHRNB4 cholinergic receptor, nicotinic, beta 4 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNB4 |
Synonyms | CHRNB4; cholinergic receptor, nicotinic, beta 4 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 4; neuronal acetylcholine receptor subunit beta-4; acetylcholine receptor; nicotinic; beta 4 (neuronal); neuronal nicotinic receptor beta 4 subunit; acetylcholine receptor, nicotinic, beta 4 (neuronal); |
Gene ID | 1143 |
mRNA Refseq | NM_000750 |
Protein Refseq | NP_000741 |
MIM | 118509 |
UniProt ID | P30926 |
◆ Cell & Tissue Lysates | ||
CHRNB4-7511HCL | Recombinant Human CHRNB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHRNB4 Products
Required fields are marked with *
My Review for All CHRNB4 Products
Required fields are marked with *
0
Inquiry Basket