Recombinant Human CHRNB4 Protein, GST-Tagged

Cat.No. : CHRNB4-1290H
Product Overview : Human CHRNB4 partial ORF (NP_000741, 68 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CHRNB4 (Cholinergic Receptor Nicotinic Beta 4 Subunit) is a Protein Coding gene. Diseases associated with CHRNB4 include Substance Dependence and Nicotine Dependence, Protection Against. Among its related pathways are Innate Immune System and Sudden Infant Death Syndrome (SIDS) Susceptibility Pathways. GO annotations related to this gene include extracellular ligand-gated ion channel activity and ligand-gated ion channel activity. An important paralog of this gene is CHRNB2.
Molecular Mass : 37.84 kDa
AA Sequence : VNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHRNB4 cholinergic receptor, nicotinic, beta 4 (neuronal) [ Homo sapiens ]
Official Symbol CHRNB4
Synonyms CHRNB4; cholinergic receptor, nicotinic, beta 4 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 4; neuronal acetylcholine receptor subunit beta-4; acetylcholine receptor; nicotinic; beta 4 (neuronal); neuronal nicotinic receptor beta 4 subunit; acetylcholine receptor, nicotinic, beta 4 (neuronal);
Gene ID 1143
mRNA Refseq NM_000750
Protein Refseq NP_000741
MIM 118509
UniProt ID P30926

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNB4 Products

Required fields are marked with *

My Review for All CHRNB4 Products

Required fields are marked with *

0
cart-icon