Recombinant Human CHRNG protein, His-tagged
| Cat.No. : | CHRNG-7855H |
| Product Overview : | Recombinant Human CHRNG protein(279-422 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 279-422 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | LRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CHRNG cholinergic receptor, nicotinic, gamma (muscle) [ Homo sapiens ] |
| Official Symbol | CHRNG |
| Synonyms | CHRNG; cholinergic receptor, nicotinic, gamma (muscle); ACHRG, cholinergic receptor, nicotinic, gamma; acetylcholine receptor subunit gamma; acetylcholine receptor; nicotinic; gamma (muscle); acetylcholine receptor, muscle, gamma subunit; acetylcholine receptor, nicotinic, gamma (muscle); cholinergic receptor, nicotinic, gamma polypeptide; ACHRG; MGC133376; |
| Gene ID | 1146 |
| mRNA Refseq | NM_005199 |
| Protein Refseq | NP_005190 |
| MIM | 100730 |
| UniProt ID | P07510 |
| ◆ Recombinant Proteins | ||
| CHRNG-7855H | Recombinant Human CHRNG protein, His-tagged | +Inquiry |
| CHRNG-3210C | Recombinant Chicken CHRNG | +Inquiry |
| CHRNG-5645H | Recombinant Human CHRNG protein, His-tagged | +Inquiry |
| CHRNG-1060R | Recombinant Rat CHRNG Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHRNG-1730H | Recombinant Human CHRNG Protein (Arg23-Ala250), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNG Products
Required fields are marked with *
My Review for All CHRNG Products
Required fields are marked with *
