Recombinant Human CHRNG protein, His-tagged

• Cat.No.: CHRNG-7855H
• Product Overview: Recombinant Human CHRNG protein(279-422 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 279-422 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: LRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CHRNG cholinergic receptor, nicotinic, gamma (muscle) [ Homo sapiens ]
• Official Symbol: CHRNG
• Synonyms: CHRNG; cholinergic receptor, nicotinic, gamma (muscle); ACHRG, cholinergic receptor, nicotinic, gamma; acetylcholine receptor subunit gamma; acetylcholine receptor; nicotinic; gamma (muscle); acetylcholine receptor, muscle, gamma subunit; acetylcholine receptor, nicotinic, gamma (muscle); cholinergic receptor, nicotinic, gamma polypeptide; ACHRG; MGC133376
• Gene ID: 1146
• mRNA Refseq: NM_005199
• Protein Refseq: NP_005190
• MIM: 100730
• UniProt ID: P07510