Recombinant Human CHRNG protein, His-tagged
Cat.No. : | CHRNG-7855H |
Product Overview : | Recombinant Human CHRNG protein(279-422 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 279-422 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | LRSPHTHSMARGVRKVFLRLLPQLLRMHVRPLAPAAVQDTQSRLQNGSSGWSITTGEEVALCLPRSELLFQQWQRQGLVAAALEKLEKGPELGLSQFCGSLKQAAPAIQACVEACNLIACARHQQSHFDNGNEEWFLVGRVLDR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | CHRNG cholinergic receptor, nicotinic, gamma (muscle) [ Homo sapiens ] |
Official Symbol | CHRNG |
Synonyms | CHRNG; cholinergic receptor, nicotinic, gamma (muscle); ACHRG, cholinergic receptor, nicotinic, gamma; acetylcholine receptor subunit gamma; acetylcholine receptor; nicotinic; gamma (muscle); acetylcholine receptor, muscle, gamma subunit; acetylcholine receptor, nicotinic, gamma (muscle); cholinergic receptor, nicotinic, gamma polypeptide; ACHRG; MGC133376; |
Gene ID | 1146 |
mRNA Refseq | NM_005199 |
Protein Refseq | NP_005190 |
MIM | 100730 |
UniProt ID | P07510 |
◆ Recombinant Proteins | ||
Chrng-3058M | Recombinant Mouse Chrng, His-tagged | +Inquiry |
CHRNG-783H | Recombinant Human CHRNG Protein, His&GST-tagged | +Inquiry |
CHRNG-1730H | Recombinant Human CHRNG Protein (Arg23-Ala250), N-His tagged | +Inquiry |
CHRNG-1402R | Recombinant Rat CHRNG Protein | +Inquiry |
CHRNG-3210C | Recombinant Chicken CHRNG | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNG Products
Required fields are marked with *
My Review for All CHRNG Products
Required fields are marked with *