Recombinant Human CHRNG protein, His-tagged

Cat.No. : CHRNG-5645H
Product Overview : Recombinant Human CHRNG protein(P07510)(23-240aa), fused with N-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 23-240aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 29.6 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK
Gene Name CHRNG cholinergic receptor, nicotinic, gamma (muscle) [ Homo sapiens ]
Official Symbol CHRNG
Synonyms CHRNG; cholinergic receptor, nicotinic, gamma (muscle); ACHRG, cholinergic receptor, nicotinic, gamma; acetylcholine receptor subunit gamma; acetylcholine receptor; nicotinic; gamma (muscle); acetylcholine receptor, muscle, gamma subunit; acetylcholine receptor, nicotinic, gamma (muscle); cholinergic receptor, nicotinic, gamma polypeptide; ACHRG; MGC133376;
Gene ID 1146
mRNA Refseq NM_005199
Protein Refseq NP_005190
MIM 100730
UniProt ID P07510

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHRNG Products

Required fields are marked with *

My Review for All CHRNG Products

Required fields are marked with *

0
cart-icon