Recombinant Human CHRNG protein, His-tagged

• Cat.No.: CHRNG-5645H
• Product Overview: Recombinant Human CHRNG protein(P07510)(23-240aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 23-240aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.6 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK

Gene Information

• Gene Name: CHRNG cholinergic receptor, nicotinic, gamma (muscle) [ Homo sapiens ]
• Official Symbol: CHRNG
• Synonyms: CHRNG; cholinergic receptor, nicotinic, gamma (muscle); ACHRG, cholinergic receptor, nicotinic, gamma; acetylcholine receptor subunit gamma; acetylcholine receptor; nicotinic; gamma (muscle); acetylcholine receptor, muscle, gamma subunit; acetylcholine receptor, nicotinic, gamma (muscle); cholinergic receptor, nicotinic, gamma polypeptide; ACHRG; MGC133376
• Gene ID: 1146
• mRNA Refseq: NM_005199
• Protein Refseq: NP_005190
• MIM: 100730
• UniProt ID: P07510