Recombinant Human CHRNG protein, His-tagged
Cat.No. : | CHRNG-5645H |
Product Overview : | Recombinant Human CHRNG protein(P07510)(23-240aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-240aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.6 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | RNQEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPRDYEGLWVLRVPSTMVWRPDIVLENNVDGVFEVALYCNVLVSPDGCIYWLPPAIFRSACSISVTYFPFDWQNCSLIFQSQTYSTNEIDLQLSQEDGQTIEWIFIDPEAFTENGEWAIQHRPAKMLLDPAAPAQEAGHQKVVFYLLIQRK |
Gene Name | CHRNG cholinergic receptor, nicotinic, gamma (muscle) [ Homo sapiens ] |
Official Symbol | CHRNG |
Synonyms | CHRNG; cholinergic receptor, nicotinic, gamma (muscle); ACHRG, cholinergic receptor, nicotinic, gamma; acetylcholine receptor subunit gamma; acetylcholine receptor; nicotinic; gamma (muscle); acetylcholine receptor, muscle, gamma subunit; acetylcholine receptor, nicotinic, gamma (muscle); cholinergic receptor, nicotinic, gamma polypeptide; ACHRG; MGC133376; |
Gene ID | 1146 |
mRNA Refseq | NM_005199 |
Protein Refseq | NP_005190 |
MIM | 100730 |
UniProt ID | P07510 |
◆ Recombinant Proteins | ||
CHRNG-1402R | Recombinant Rat CHRNG Protein | +Inquiry |
CHRNG-1060R | Recombinant Rat CHRNG Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRNG-1730H | Recombinant Human CHRNG Protein (Arg23-Ala250), N-His tagged | +Inquiry |
CHRNG-783H | Recombinant Human CHRNG Protein, His&GST-tagged | +Inquiry |
CHRNG-7855H | Recombinant Human CHRNG protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRNG Products
Required fields are marked with *
My Review for All CHRNG Products
Required fields are marked with *