Recombinant Human Chromodomain Helicase DNA Binding Protein 7, His-tagged
Cat.No. : | CHD7-4914H |
Product Overview : | Recombinant full length human CHD7 containing N-terminal His tag was expressed by E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CHD7 is a N-terminal His-tagged recombinant protein and a member of the Sso7d family of small, abundant, non-specific DNA-binding proteins from the hyperthermophilic Archea Sulfolobus. The 7-kDa protein from Sulfolobus spp. consists of a five stranded, incomplete β-barrel capped at the opening by a C-terminal α-helix; they bind to the minor groove of a DNA duplex via the triple-stranded β-sheet. |
Molecular Weight : | 9.44 kDa |
Form : | Sterile filtered and lyophilized with no additives. |
Appearance : | Lyophilized protein |
Sequence : | MGSSHHHHHHSSGLVPRGSHMATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK |
Endotoxin Level : | <0.1 ng/μg |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in ddH2O to a concentration of 1.0 mg/ml. Aliquot and store at -20°C for future use. Repeated freeze/thaw cycles should be avoided. |
Purity : | >99% by SDS-PAGE |
Storage : | The lyophilized CHD7 is best-stored desiccated below 0°C. Reconstituted protein should be stored in working aliquots at -20°C. |
Pathways : | Noncanonical Wnt signaling pathway |
Full Length : | Full L. |
Gene Name | CHD7 chromodomain helicase DNA binding protein 7 [ Homo sapiens ] |
Official Symbol | CHD7 |
Synonyms | CHD7; chromodomain helicase DNA binding protein 7; IS3; KAL5; FLJ20357; FLJ20361; KIAA1416; chromodomain-helicase-DNA-binding protein 7; OTTHUMP00000229376; ATP-dependent helicase CHD7; chromodomain helicase DNA binding protein 7 isoform CRA_e; EC 3.6.4.12 |
Gene ID | 55636 |
mRNA Refseq | NM_017780 |
Protein Refseq | NP_060250 |
MIM | 608892 |
UniProt ID | Q9P2D1 |
Chromosome Location | 8q12.2 |
Function | ATP binding; DNA binding; chromatin binding; helicase activity; hydrolase activity, acting on acid anhydrides; nucleotide binding |
◆ Recombinant Proteins | ||
CHD7-1216H | Recombinant Human CHD7 Protein | +Inquiry |
CHD7-4914H | Recombinant Human Chromodomain Helicase DNA Binding Protein 7, His-tagged | +Inquiry |
CHD7-08H | Recombinant Human CHD7 Protein, His tagged | +Inquiry |
CHD7-3382M | Recombinant Mouse CHD7 Protein | +Inquiry |
CHD7-3513C | Recombinant Chicken CHD7 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHD7 Products
Required fields are marked with *
My Review for All CHD7 Products
Required fields are marked with *