Recombinant Human CHST15 protein, His-tagged
| Cat.No. : | CHST15-3487H |
| Product Overview : | Recombinant Human CHST15 protein(103-451 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 103-451 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | QELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSVNNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTTDPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CHST15 carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15 [ Homo sapiens ] |
| Official Symbol | CHST15 |
| Synonyms | CHST15; carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15; carbohydrate sulfotransferase 15; B cell RAG associated protein; BRAG; GALNAC4S 6ST; KIAA0598; N acetylgalactosamine 4 sulfate 6 O sulfotransferase; hBRAG; B-cell RAG-associated gene protein; B cell RAG associated protein (GALNAC4S-6ST); N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase; GALNAC4S-6ST; RP11-47G11.1; MGC34346; DKFZp781H1369; |
| Gene ID | 51363 |
| mRNA Refseq | NM_014863 |
| Protein Refseq | NP_055678 |
| MIM | 608277 |
| UniProt ID | Q7LFX5 |
| ◆ Recombinant Proteins | ||
| CHST15-4686H | Recombinant Human CHST15 Protein, GST-tagged | +Inquiry |
| CHST15-3197H | Recombinant Human CHST15 protein, His-tagged | +Inquiry |
| CHST15-5140HF | Recombinant Full Length Human CHST15 Protein, GST-tagged | +Inquiry |
| CHST15-3450M | Recombinant Mouse CHST15 Protein | +Inquiry |
| CHST15-11228H | Recombinant Human CHST15, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHST15-2183HCL | Recombinant Human CHST15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST15 Products
Required fields are marked with *
My Review for All CHST15 Products
Required fields are marked with *
