Recombinant Human CIAO1 protein, His-SUMO-tagged
Cat.No. : | CIAO1-2698H |
Product Overview : | Recombinant Human CIAO1 protein(O76071)(1-339aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-339aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 53.8 kDa |
AA Sequence : | MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWSPCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEYECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLASCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CIAO1 cytosolic iron-sulfur protein assembly 1 [ Homo sapiens ] |
Official Symbol | CIAO1 |
Synonyms | CIAO1; cytosolic iron-sulfur protein assembly 1; cytosolic iron sulfur protein assembly 1 homolog (S. cerevisiae) , WD repeat domain 39 , WDR39; probable cytosolic iron-sulfur protein assembly protein CIAO1; CIA1; WD40 protein Ciao1; WD repeat domain 39; WD repeat-containing protein 39; cytosolic iron-sulfur protein assembly 1 homolog; WDR39; |
Gene ID | 9391 |
mRNA Refseq | NM_004804 |
Protein Refseq | NP_004795 |
MIM | 604333 |
UniProt ID | O76071 |
◆ Recombinant Proteins | ||
CIAO1-1410R | Recombinant Rat CIAO1 Protein | +Inquiry |
Ciao1-2162M | Recombinant Mouse Ciao1 Protein, Myc/DDK-tagged | +Inquiry |
CIAO1-3464M | Recombinant Mouse CIAO1 Protein | +Inquiry |
CIAO1-1684M | Recombinant Mouse CIAO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CIAO1-1068R | Recombinant Rat CIAO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIAO1-7501HCL | Recombinant Human CIAO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIAO1 Products
Required fields are marked with *
My Review for All CIAO1 Products
Required fields are marked with *