"CIART" Related Products

Recombinant Human CIART protein, T7/His-tagged

Cat.No.: CIART-217H
Product Overview: Recombinant human CHRONO ( 384 aa, derived from BC027999 ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGGSDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPD TVGQRGGSRPSPGPIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQK CKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQIAA QKSSLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLS SPGTISFSHGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWS YTLSPPSLPTLARKMTIGHREQQRSHPPVAADAHLLNL
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: CIART circadian associated repressor of transcription [ Homo sapiens ]
Official Symbol: CIART
Synonyms: GM129; CHRONO; C1orf51
Gene ID: 148523
mRNA Refseq: NM_001300838
Protein Refseq: NP_001287767
MIM: 615782
UniProt ID: Q8N365
Chromosome Location: 1q21.2
Function: E-box binding; core promoter sequence-specific DNA binding; protein binding; chIP-derived repressor of network oscillator; computationally highlighted repressor of the network oscillator

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.