Recombinant Human CIART protein, T7/His-tagged
Cat.No. : | CIART-217H |
Product Overview : | Recombinant human CHRONO ( 384 aa, derived from BC027999 ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Form : | 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGGSDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPD TVGQRGGSRPSPGPIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFAQK CKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQIAA QKSSLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHLALKPKQPWHLTQWPAMNLTWIHTTPICNPPLS SPGTISFSHGPLGTGTGIGVILFLQHGVQPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWS YTLSPPSLPTLARKMTIGHREQQRSHPPVAADAHLLNL |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | CIART circadian associated repressor of transcription [ Homo sapiens ] |
Official Symbol | CIART |
Synonyms | GM129; CHRONO; C1orf51 |
Gene ID | 148523 |
mRNA Refseq | NM_001300838 |
Protein Refseq | NP_001287767 |
MIM | 615782 |
UniProt ID | Q8N365 |
Chromosome Location | 1q21.2 |
Function | E-box binding; core promoter sequence-specific DNA binding; protein binding; chIP-derived repressor of network oscillator; computationally highlighted repressor of the network oscillator |
◆ Recombinant Proteins | ||
CIART-217H | Recombinant Human CIART protein, T7/His-tagged | +Inquiry |
CIART-701R | Recombinant Rhesus Macaque CIART Protein, His (Fc)-Avi-tagged | +Inquiry |
CIART-875R | Recombinant Rhesus monkey CIART Protein, His-tagged | +Inquiry |
CIART-6754H | Recombinant Human CIART protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIART Products
Required fields are marked with *
My Review for All CIART Products
Required fields are marked with *