Recombinant Human CIB2 Protein, GST-tagged

Cat.No. : CIB2-1357H
Product Overview : Human CIB2 full-length ORF (AAH47381.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is similar to that of KIP/CIB, calcineurin B, and calmodulin. The encoded protein is a calcium-binding regulatory protein that interacts with DNA-dependent protein kinase catalytic subunits (DNA-PKcs), and it is involved in photoreceptor cell maintenance. Mutations in this gene cause deafness, autosomal recessive, 48 (DFNB48), and also Usher syndrome 1J (USH1J). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Molecular Mass : 46.97 kDa
AA Sequence : MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CIB2 calcium and integrin binding family member 2 [ Homo sapiens ]
Official Symbol CIB2
Synonyms CIB2; calcium and integrin binding family member 2; calcium and integrin-binding family member 2; KIP2; KIP 2; 2810434I23Rik; kinase-interacting protein 2; DNA-dependent protein kinase catalytic subunit-interacting protein 2;
Gene ID 10518
mRNA Refseq NM_006383
Protein Refseq NP_006374
MIM 605564
UniProt ID O75838

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CIB2 Products

Required fields are marked with *

My Review for All CIB2 Products

Required fields are marked with *

0
cart-icon
0
compare icon