Recombinant Human CIDEB Protein, GST-tagged
| Cat.No. : | CIDEB-1362H |
| Product Overview : | Human CIDEB full-length ORF ( AAH35970, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CIDEB (Cell Death-Inducing DFFA-Like Effector B) is a Protein Coding gene. GO annotations related to this gene include identical protein binding. An important paralog of this gene is CIDEC. |
| Molecular Mass : | 49.83 kDa |
| AA Sequence : | MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGLGRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CIDEB cell death-inducing DFFA-like effector b [ Homo sapiens ] |
| Official Symbol | CIDEB |
| Synonyms | CIDEB; cell death-inducing DFFA-like effector b; cell death activator CIDE-B; |
| Gene ID | 27141 |
| mRNA Refseq | NM_014430 |
| Protein Refseq | NP_055245 |
| MIM | 604441 |
| UniProt ID | Q9UHD4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIDEB Products
Required fields are marked with *
My Review for All CIDEB Products
Required fields are marked with *
