Recombinant Human CILP Protein, GST-tagged
Cat.No. : | CILP-1367H |
Product Overview : | Human CILP partial ORF ( NP_003604, 129 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for two different proteins; an N-terminal CILP and a C-terminal homolog of NTPPHase, however, later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. The full-length and the N-terminal domain of this protein was shown to function as an IGF-1 antagonist. An allelic variant of this gene has been associated with lumbar disc disease. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 36.52 kDa |
AA Sequence : | NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CILP cartilage intermediate layer protein, nucleotide pyrophosphohydrolase [ Homo sapiens ] |
Official Symbol | CILP |
Synonyms | CILP; cartilage intermediate layer protein, nucleotide pyrophosphohydrolase; cartilage intermediate layer protein 1; HsT18872; cartilage intermediate-layer protein; cartilage intermediate layer protein 1 C1; cartilage intermediate layer protein 1 C2; CILP-1; |
Gene ID | 8483 |
mRNA Refseq | NM_003613 |
Protein Refseq | NP_003604 |
MIM | 603489 |
UniProt ID | O75339 |
◆ Recombinant Proteins | ||
CILP-69H | Recombinant Human CILP protein, T7/His-tagged | +Inquiry |
CILP-2243H | Recombinant Human CILP Protein (Ile603-Ala846), N-GST tagged | +Inquiry |
CILP-2755H | Recombinant Human CILP Protein (725-1184 aa), His-MBP-tagged | +Inquiry |
CILP-1693M | Recombinant Mouse CILP Protein, His (Fc)-Avi-tagged | +Inquiry |
CILP-538H | Active Recombinant Human CILP Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CILP-7494HCL | Recombinant Human CILP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CILP Products
Required fields are marked with *
My Review for All CILP Products
Required fields are marked with *