Recombinant Human CILP Protein, GST-tagged

Cat.No. : CILP-1367H
Product Overview : Human CILP partial ORF ( NP_003604, 129 a.a. - 226 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. The encoded protein was thought to encode a protein precursor for two different proteins; an N-terminal CILP and a C-terminal homolog of NTPPHase, however, later studies identified no nucleotide pyrophosphatase phosphodiesterase (NPP) activity. The full-length and the N-terminal domain of this protein was shown to function as an IGF-1 antagonist. An allelic variant of this gene has been associated with lumbar disc disease. [provided by RefSeq, Sep 2010]
Molecular Mass : 36.52 kDa
AA Sequence : NCSNYTVRFLCPPGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMGQVNADCDACMCQDFML
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CILP cartilage intermediate layer protein, nucleotide pyrophosphohydrolase [ Homo sapiens ]
Official Symbol CILP
Synonyms CILP; cartilage intermediate layer protein, nucleotide pyrophosphohydrolase; cartilage intermediate layer protein 1; HsT18872; cartilage intermediate-layer protein; cartilage intermediate layer protein 1 C1; cartilage intermediate layer protein 1 C2; CILP-1;
Gene ID 8483
mRNA Refseq NM_003613
Protein Refseq NP_003604
MIM 603489
UniProt ID O75339

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CILP Products

Required fields are marked with *

My Review for All CILP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon