Recombinant Human CINP protein, GST-tagged

Cat.No. : CINP-6732H
Product Overview : Recombinant Human CINP protein(1-212 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-212 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol CINP
Synonyms CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849; CDK2-interacting protein;
Gene ID 51550
mRNA Refseq NM_032630
Protein Refseq NP_116019
MIM 613362
UniProt ID Q9BW66

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CINP Products

Required fields are marked with *

My Review for All CINP Products

Required fields are marked with *

0
cart-icon
0
compare icon