Recombinant Human CINP protein, GST-tagged
| Cat.No. : | CINP-6732H |
| Product Overview : | Recombinant Human CINP protein(1-212 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-212 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | CINP |
| Synonyms | CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849; CDK2-interacting protein; |
| Gene ID | 51550 |
| mRNA Refseq | NM_032630 |
| Protein Refseq | NP_116019 |
| MIM | 613362 |
| UniProt ID | Q9BW66 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CINP Products
Required fields are marked with *
My Review for All CINP Products
Required fields are marked with *



