Recombinant Human CINP protein, GST-tagged
Cat.No. : | CINP-6732H |
Product Overview : | Recombinant Human CINP protein(1-212 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-212 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | CINP |
Synonyms | CINP; cyclin-dependent kinase 2 interacting protein; cyclin-dependent kinase 2-interacting protein; MGC849; CDK2-interacting protein; |
Gene ID | 51550 |
mRNA Refseq | NM_032630 |
Protein Refseq | NP_116019 |
MIM | 613362 |
UniProt ID | Q9BW66 |
◆ Recombinant Proteins | ||
CINP-4775H | Recombinant Human CINP protein, His-SUMO-tagged | +Inquiry |
CINP-3477M | Recombinant Mouse CINP Protein | +Inquiry |
CINP-27247TH | Recombinant Human CINP, His-tagged | +Inquiry |
CINP-1694M | Recombinant Mouse CINP Protein, His (Fc)-Avi-tagged | +Inquiry |
CINP-1368H | Recombinant Human CINP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CINP-7493HCL | Recombinant Human CINP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CINP Products
Required fields are marked with *
My Review for All CINP Products
Required fields are marked with *