Recombinant Human CISD2 protein, His-tagged
| Cat.No. : | CISD2-11254H | 
| Product Overview : | Recombinant Human CISD2 protein(61-135 aa), fused with N-terminal His tag, was expressed in E.coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 61-135 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. | 
| AASequence : | PKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | CISD2 CDGSH iron sulfur domain 2 [ Homo sapiens ] | 
| Official Symbol | CISD2 | 
| Synonyms | 1500009M05Rik; 1500026J14Rik; 1500031D15Rik; AI848398; B630006A20Rik; CDGSH iron sulfur domain 2; CDGSH iron-sulfur domain-containing protein 2; CDGSH type domain 2; CISD2; CISD2_HUMAN; Endoplasmic reticulum intermembrane small protein; ERIS; Miner1; MitoNEET related 1; MitoNEET-related 1 protein; NAF-1; Noxp70; Nutrient deprivation autophagy factor 1; Nutrient-deprivation autophagy factor-1; OTTHUMP00000219576; RGD1566242; WFS2; Zcd2; Zinc finger; Zinc finger, CDGSH type domain 2; | 
| Gene ID | 493856 | 
| mRNA Refseq | NM_001008388.4 | 
| Protein Refseq | NP_001008389.1 | 
| MIM | 611507 | 
| UniProt ID | Q8N5K1 | 
| ◆ Recombinant Proteins | ||
| CISD2-11254H | Recombinant Human CISD2 protein, His-tagged | +Inquiry | 
| CISD2-3482M | Recombinant Mouse CISD2 Protein | +Inquiry | 
| CISD2-1855HF | Recombinant Full Length Human CISD2 Protein, GST-tagged | +Inquiry | 
| CISD2-10698Z | Recombinant Zebrafish CISD2 | +Inquiry | 
| CISD2-1379H | Recombinant Human CISD2 Protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CISD2-7489HCL | Recombinant Human CISD2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CISD2 Products
Required fields are marked with *
My Review for All CISD2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            