Recombinant Human CISD2 Protein, GST-tagged

Cat.No. : CISD2-1379H
Product Overview : Human CISD2 full-length ORF ( NP_001008389.1, 1 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a zinc finger protein that localizes to the endoplasmic reticulum. The encoded protein binds an iron/sulfur cluster and may be involved in calcium homeostasis. Defects in this gene are a cause of Wolfram syndrome 2. [provided by RefSeq, Mar 2011]
Molecular Mass : 41.7 kDa
AA Sequence : MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSLINLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CISD2 CDGSH iron sulfur domain 2 [ Homo sapiens ]
Official Symbol CISD2
Synonyms 1500009M05Rik; 1500026J14Rik; 1500031D15Rik; AI848398; B630006A20Rik; CDGSH iron sulfur domain 2; CDGSH iron-sulfur domain-containing protein 2; CDGSH type domain 2; CISD2; CISD2_HUMAN; Endoplasmic reticulum intermembrane small protein; ERIS; Miner1; MitoNEET related 1; MitoNEET-related 1 protein; NAF-1; Noxp70; Nutrient deprivation autophagy factor 1; Nutrient-deprivation autophagy factor-1; OTTHUMP00000219576; RGD1566242; WFS2; Zcd2; Zinc finger; Zinc finger, CDGSH type domain 2;
Gene ID 493856
mRNA Refseq NM_001008388.4
Protein Refseq NP_001008389.1
MIM 611507
UniProt ID Q8N5K1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CISD2 Products

Required fields are marked with *

My Review for All CISD2 Products

Required fields are marked with *

0
cart-icon
0
compare icon