Recombinant Human CITED1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CITED1-4778H |
Product Overview : | CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_004134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. |
Molecular Mass : | 19.9 kDa |
AA Sequence : | MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CITED1 Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1 [ Homo sapiens (human) ] |
Official Symbol | CITED1 |
Synonyms | CITED1; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1; MSG1; cbp/p300-interacting transactivator 1; melanocyte-specific gene 1; melanocyte-specific protein 1; |
Gene ID | 4435 |
mRNA Refseq | NM_004143 |
Protein Refseq | NP_004134 |
MIM | 300149 |
UniProt ID | Q99966 |
◆ Recombinant Proteins | ||
CITED1-1385H | Recombinant Human CITED1 Protein, GST-tagged | +Inquiry |
CITED1-2118H | Recombinant Human CITED1 Protein (Met1-Cys193), N-His tagged | +Inquiry |
CITED1-1701M | Recombinant Mouse CITED1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CITED1-883R | Recombinant Rhesus monkey CITED1 Protein, His-tagged | +Inquiry |
Cited1-1713M | Recombinant Mouse Cited1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CITED1-7487HCL | Recombinant Human CITED1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CITED1 Products
Required fields are marked with *
My Review for All CITED1 Products
Required fields are marked with *