Recombinant Human CITED1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CITED1-4778H
• Product Overview: CITED1 MS Standard C13 and N15-labeled recombinant protein (NP_004134) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described.
• Molecular Mass: 19.9 kDa
• AA Sequence: MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CITED1 Cbp/p300 interacting transactivator with Glu/Asp rich carboxy-terminal domain 1 [ Homo sapiens (human) ]
• Official Symbol: CITED1
• Synonyms: CITED1; Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1; MSG1; cbp/p300-interacting transactivator 1; melanocyte-specific gene 1; melanocyte-specific protein 1
• Gene ID: 4435
• mRNA Refseq: NM_004143
• Protein Refseq: NP_004134
• MIM: 300149
• UniProt ID: Q99966