Recombinant Human CKM Protein, GST-tagged
Cat.No. : | CKM-1397H |
Product Overview : | Human CKM full-length ORF ( AAH07462, 1 a.a. - 381 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 67.65 kDa |
AA Sequence : | MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDCHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLAGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CKM creatine kinase, muscle [ Homo sapiens ] |
Official Symbol | CKM |
Synonyms | CKM; creatine kinase, muscle; CKMM; creatine kinase M-type; creatine kinase-M; creatine kinase M chain; M-CK; |
Gene ID | 1158 |
mRNA Refseq | NM_001824 |
Protein Refseq | NP_001815 |
MIM | 123310 |
UniProt ID | P06732 |
◆ Recombinant Proteins | ||
CKM-1734H | Recombinant Human CKM Protein (Met1-Lys381), C-His tagged | +Inquiry |
CKM-2571H | Recombinant Human CKM protein(21-120 aa), C-His-tagged | +Inquiry |
CKM-1199HFL | Recombinant Full Length Human CKM Protein, C-Flag-tagged | +Inquiry |
CKM-674C | Recombinant Cat CKM protein | +Inquiry |
CKM-932H | Recombinant Human Creatine Kinase, Muscle | +Inquiry |
◆ Native Proteins | ||
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
CKM-5306H | Native Human creatine kinase, muscle | +Inquiry |
CKMM-382H | Native Human Creatine Kinase MM (CK-MM) | +Inquiry |
CKMM-166M | Native Mouse Creatine Kinase MM | +Inquiry |
Ckmm-167R | Native Rat Creatine Kinase MM | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKM-7483HCL | Recombinant Human CKM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKM Products
Required fields are marked with *
My Review for All CKM Products
Required fields are marked with *