Recombinant Human CKS2, T7 -tagged

Cat.No. : CKS2-26704TH
Product Overview : Recombinant full length protein corresponding to amino acids 1-79 of Human CKS2, fused to a T7 Tag at N-terminal, MWt 11kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 79 amino acids
Description : CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein.
Conjugation : T7
Molecular Weight : 11.000kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 7.50Constituents:0.32% Tris HCl, 20% Glycerol
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MASMTGGQQMGRGSHMAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ
Sequence Similarities : Belongs to the CKS family.
Gene Name CKS2 CDC28 protein kinase regulatory subunit 2 [ Homo sapiens ]
Official Symbol CKS2
Synonyms CKS2; CDC28 protein kinase regulatory subunit 2; CDC28 protein kinase 2; cyclin-dependent kinases regulatory subunit 2;
Gene ID 1164
mRNA Refseq NM_001827
Protein Refseq NP_001818
MIM 116901
Uniprot ID P33552
Chromosome Location 9q22
Function cyclin-dependent protein kinase regulator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CKS2 Products

Required fields are marked with *

My Review for All CKS2 Products

Required fields are marked with *

0
cart-icon