Recombinant Human CKS2, T7 -tagged
Cat.No. : | CKS2-26704TH |
Product Overview : | Recombinant full length protein corresponding to amino acids 1-79 of Human CKS2, fused to a T7 Tag at N-terminal, MWt 11kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 79 amino acids |
Description : | CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. |
Conjugation : | T7 |
Molecular Weight : | 11.000kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 7.50Constituents:0.32% Tris HCl, 20% Glycerol |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASMTGGQQMGRGSHMAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ |
Sequence Similarities : | Belongs to the CKS family. |
Gene Name | CKS2 CDC28 protein kinase regulatory subunit 2 [ Homo sapiens ] |
Official Symbol | CKS2 |
Synonyms | CKS2; CDC28 protein kinase regulatory subunit 2; CDC28 protein kinase 2; cyclin-dependent kinases regulatory subunit 2; |
Gene ID | 1164 |
mRNA Refseq | NM_001827 |
Protein Refseq | NP_001818 |
MIM | 116901 |
Uniprot ID | P33552 |
Chromosome Location | 9q22 |
Function | cyclin-dependent protein kinase regulator activity; |
◆ Recombinant Proteins | ||
CKS2-3500M | Recombinant Mouse CKS2 Protein | +Inquiry |
CKS2-26704TH | Recombinant Human CKS2, T7 -tagged | +Inquiry |
CKS2-26705TH | Recombinant Human CKS2, T7 -tagged | +Inquiry |
CKS2-0156H | Recombinant Human CKS2 Protein (M1-K79), His tagged | +Inquiry |
CKS2-4059Z | Recombinant Zebrafish CKS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKS2-7480HCL | Recombinant Human CKS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CKS2 Products
Required fields are marked with *
My Review for All CKS2 Products
Required fields are marked with *
0
Inquiry Basket