Recombinant Human CLCN5 protein, His-tagged

• Cat.No.: CLCN5-3998H
• Product Overview: Recombinant Human CLCN5 protein(627-685 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 627-685 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: ESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPLPPYTPPTLKLRNILDL
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CLCN5 chloride channel, voltage-sensitive 5 [ Homo sapiens ]
• Official Symbol: CLCN5
• Synonyms: CLCN5; chloride channel, voltage-sensitive 5; chloride channel 5 , nephrolithiasis 1 (X linked) , nephrolithiasis 2, X linked , NPHL1, NPHL2; H(+)/Cl(-) exchange transporter 5; ClC 5; CLC5; Dent disease; DENTS; hCIC K2; hClC K2; XLRH; XRN; chloride channel 5; chloride channel protein 5; chloride transporter ClC-5; CLCK2; NPHL1; NPHL2; clC-5; hCIC-K2; hClC-K2
• Gene ID: 1184
• mRNA Refseq: NM_000084
• Protein Refseq: NP_000075
• MIM: 300008
• UniProt ID: P51795