Recombinant Human CLDN17 Protein, GST-tagged
Cat.No. : | CLDN17-1435H |
Product Overview : | Human CLDN17 full-length ORF ( NP_036263.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is intronless and is clustered with CLDN8 on chromosome 21q22.11. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 51 kDa |
AA Sequence : | MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLDN17 claudin 17 [ Homo sapiens ] |
Official Symbol | CLDN17 |
Synonyms | CLDN17; claudin 17; claudin-17; MGC126552; MGC126554; human CLDN17 gene for claudin-17; |
Gene ID | 26285 |
mRNA Refseq | NM_012131 |
Protein Refseq | NP_036263 |
UniProt ID | P56750 |
◆ Recombinant Proteins | ||
RFL20807HF | Recombinant Full Length Human Claudin-17(Cldn17) Protein, His-Tagged | +Inquiry |
CLDN17-2046HF | Recombinant Full Length Human CLDN17 Protein, GST-tagged | +Inquiry |
CLDN17-3528M | Recombinant Mouse CLDN17 Protein | +Inquiry |
RFL189MF | Recombinant Full Length Mouse Claudin-17(Cldn17) Protein, His-Tagged | +Inquiry |
CLDN17-6209Z | Recombinant Zebrafish CLDN17 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN17-7467HCL | Recombinant Human CLDN17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN17 Products
Required fields are marked with *
My Review for All CLDN17 Products
Required fields are marked with *