Recombinant Human CLDN18 protein, GST-tagged

Cat.No. : CLDN18-20H
Product Overview : Recombinant Human CLDN18(196 a.a. - 261 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 196 a.a. - 261 a.a.
Description : This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 33 kDa
AA Sequence : CRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name CLDN18 claudin 18 [ Homo sapiens ]
Official Symbol CLDN18
Synonyms SFTA5; SFTPJ; surfactant associated 5; surfactant associated protein J; surfactant, pulmonary associated protein J
Gene ID 51208
mRNA Refseq NM_016369
Protein Refseq NP_057453
MIM 609210
UniProt ID P56856
Chromosome Location 3q22.3
Pathway Cell adhesion molecules (CAMs), organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Tight junction, organism-specific biosystem
Function identical protein binding; structural molecule activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN18 Products

Required fields are marked with *

My Review for All CLDN18 Products

Required fields are marked with *

0
cart-icon