Recombinant Human CLDN18 protein, GST-tagged

• Cat.No.: CLDN18-20H
• Product Overview: Recombinant Human CLDN18(196 a.a. - 261 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 196 a.a. - 261 a.a.
• Description: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is upregulated in patients with ulcerative colitis and highly overexpressed in infiltrating ductal adenocarcinomas. PKC/MAPK/AP-1 (protein kinase C/mitogen-activated protein kinase/activator protein-1) dependent pathway regulates the expression of this gene in gastric cells. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 33 kDa
• AA Sequence: CRGLAPEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDYV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CLDN18 claudin 18 [ Homo sapiens ]
• Official Symbol: CLDN18
• Synonyms: SFTA5; SFTPJ; surfactant associated 5; surfactant associated protein J; surfactant, pulmonary associated protein J
• Gene ID: 51208
• mRNA Refseq: NM_016369
• Protein Refseq: NP_057453
• MIM: 609210
• UniProt ID: P56856
• Chromosome Location: 3q22.3
• Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; Tight junction, organism-specific biosystem
• Function: identical protein binding; structural molecule activity