Recombinant Human CLDN18 protein, His-tagged
| Cat.No. : | CLDN18-6432H |
| Product Overview : | Recombinant Human CLDN18 protein(P56856)(28-80aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 28-80aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 12.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | DQWSTQDLYNNPVTAVFNYQGLWRSCVRESSGFTECRGYFTLLGLPAMLQAVR |
| ◆ Recombinant Proteins | ||
| CLDN18-20H | Recombinant Human CLDN18 protein, GST-tagged | +Inquiry |
| CLDN18-8113H | Active Recombinant Human CLDN18 protein, Twin strep-Flag-tagged | +Inquiry |
| RFL6940BF | Recombinant Full Length Bovine Claudin-18(Cldn18) Protein, His-Tagged | +Inquiry |
| RFL11404MF | Recombinant Full Length Macaca Fascicularis Claudin(Cldn18)-Vlps (Active) Protein, His-Tagged | +Inquiry |
| CLDN18-794H | Recombinant Human CLDN18 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CLDN18-33H | Active Recombinant Full Length Human CLDN18 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN18 Products
Required fields are marked with *
My Review for All CLDN18 Products
Required fields are marked with *
