"CLEC14A" Related Products

Expand
Expand
Expand

Recombinant Human CLEC14A protein, T7/His-tagged

Cat.No.: CLEC14A-56H
Product Overview: Recombinant human CLEC14A cDNA (22 – 398 aa, derived from BC031567) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFEHPTADRAGCSASGACYSLHHATMKRQAAEEACILRGGALSTVRAG AELRAVLALLRAGPGPGGGSKDLLFWVALERRRSHCTLENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTARR CAVLQATGGVEPAGWKEMRCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVSALCR GQLPISVTCIADEIGARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSGEG QPTLGGTGVPTRRPPATATSPVPQRTWPIRVDEKLGETPLVPEQDNSVTSIPEIPRWGSQSTMSTLQMSLQAESK ATITPSGSVISKFNSTTSSATPQAFDSSSAV
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro CLEC14A protein mediated tumor endothelial cell formation regulation study with this protein as either coating matrix protein or as soluble factor.2. May be used for CLEC14A protein – protein interaction assay.3. May be used as enzymatic substrate for various proteases.4. May be used for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: CLEC14A C-type lectin domain family 14, member A [ Homo sapiens ]
Official Symbol: CLEC14A
Synonyms: CLEC14A; C-type lectin domain family 14, member A; C14orf27, chromosome 14 open reading frame 27; C-type lectin domain family 14 member A; epidermal growth factor receptor 5; ClECT and EGF-like domain containing protein; CEG1; EGFR-5; C14orf27;
Gene ID: 161198
mRNA Refseq: NM_175060
Protein Refseq: NP_778230
MIM:
UniProt ID: Q86T13
Chromosome Location: 14q21.1
Function: binding; sugar binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.