Recombinant Human CLEC1A Protein, GST-tagged
Cat.No. : | CLEC1A-1458H |
Product Overview : | Human CLEC1A full-length ORF ( AAH39072, 1 a.a. - 280 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The encoded protein may play a role in regulating dendritic cell function. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Molecular Mass : | 56.54 kDa |
AA Sequence : | MQAKYSSTRDMLDDDGDTTMSLHSQGSATTRHPEPRRTEHRAPSSTWRPVALTLLTLCLVLLIGLAALGLLFFQYYQLSNTGQDTISQMEERLGNTSQELQSLQVQNIKLAGSLQHVAEKLCRELYNKAGAHRCSPRTEQWKWHGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFFYSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGMIFSKDCKELKRCVCERRAGMVKPESLHVPPETLGEGD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC1A C-type lectin domain family 1, member A [ Homo sapiens ] |
Official Symbol | CLEC1A |
Synonyms | CLEC1A; C-type lectin domain family 1, member A; C-type lectin domain family 1 member A; CLEC1; MGC34328; CLEC-1; C-type lectin-like receptor-1; |
Gene ID | 51267 |
mRNA Refseq | NM_016511 |
Protein Refseq | NP_057595 |
MIM | 606782 |
UniProt ID | Q8NC01 |
◆ Recombinant Proteins | ||
CLEC1A-903R | Recombinant Rhesus monkey CLEC1A Protein, His-tagged | +Inquiry |
CLEC1A-2152H | Recombinant Human CLEC1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLEC1A-1458H | Recombinant Human CLEC1A Protein, GST-tagged | +Inquiry |
CLEC1A-3530H | Recombinant Human CLEC1A protein, hFc-tagged | +Inquiry |
Clec1a-2185M | Recombinant Mouse Clec1a protein (Gln73-Gln269), hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC1A-1458RCL | Recombinant Rat CLEC1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC1A Products
Required fields are marked with *
My Review for All CLEC1A Products
Required fields are marked with *