Recombinant Human CLEC4C Protein, His-tagged
Cat.No. : | CLEC4C-026H |
Product Overview : | Recombinant Human CLEC4C Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Lectin-type cell surface receptor which may play a role in antigen capturing by dendritic cells. Specifically recognizes non-sialylated galactose-terminated biantennary glycans containing the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Binds to serum IgG. Efficiently targets ligand into antigen-processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. |
Molecular Mass : | ~23 kDa |
AA Sequence : | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CLEC4C C-type lectin domain family 4, member C [ Homo sapiens (human) ] |
Official Symbol | CLEC4C |
Synonyms | DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150 |
Gene ID | 170482 |
mRNA Refseq | NM_203503 |
Protein Refseq | NP_987099 |
MIM | 606677 |
UniProt ID | Q8WTT0 |
◆ Recombinant Proteins | ||
CLEC4C-1033H | Recombinant Human CLEC4C Protein (Ser67-Ile213), N-His tagged | +Inquiry |
CLEC4C-45H | Recombinant Human CLEC4C Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC4C-269H | Active Recombinant Human CLEC4C protein, Fc-tagged | +Inquiry |
CLEC4C-2214H | Recombinant Human CLEC4C protein, Fc-tagged | +Inquiry |
CLEC4C-026H | Recombinant Human CLEC4C Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLEC4C Products
Required fields are marked with *
My Review for All CLEC4C Products
Required fields are marked with *
0
Inquiry Basket