Recombinant Human CLEC4D Protein (39-215 aa), His-SUMO-tagged
| Cat.No. : | CLEC4D-1083H |
| Product Overview : | Recombinant Human CLEC4D Protein (39-215 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 39-215 aa |
| Description : | Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 36.7 kDa |
| AA Sequence : | CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | CLEC4D C-type lectin domain family 4, member D [ Homo sapiens ] |
| Official Symbol | CLEC4D |
| Synonyms | CLEC4D; Mpcl; MCL; MPCL; CLEC6; CLEC-6; CLECSF8; MGC40078; |
| Gene ID | 338339 |
| mRNA Refseq | NM_080387 |
| Protein Refseq | NP_525126 |
| MIM | 609964 |
| UniProt ID | Q8WXI8 |
| ◆ Recombinant Proteins | ||
| Clec4d-7463R | Recombinant Rat Clec4d protein, His-tagged | +Inquiry |
| CLEC4D-2491H | Recombinant Human CLEC4D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CLEC4D-797H | Recombinant Human CLEC4D Protein, His-tagged | +Inquiry |
| CLEC4D-058H | Recombinant Human CLEC4D Protein, His-tagged | +Inquiry |
| CLEC4D-3264H | Recombinant Human CLEC4D Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
| CLEC4D-1487RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
| CLEC4D-2242HCL | Recombinant Human CLEC4D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC4D Products
Required fields are marked with *
My Review for All CLEC4D Products
Required fields are marked with *
