Recombinant Human CLEC4D Protein (39-215 aa), His-SUMO-tagged

Cat.No. : CLEC4D-1083H
Product Overview : Recombinant Human CLEC4D Protein (39-215 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 39-215 aa
Description : Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 36.7 kDa
AA Sequence : CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name CLEC4D C-type lectin domain family 4, member D [ Homo sapiens ]
Official Symbol CLEC4D
Synonyms CLEC4D; Mpcl; MCL; MPCL; CLEC6; CLEC-6; CLECSF8; MGC40078;
Gene ID 338339
mRNA Refseq NM_080387
Protein Refseq NP_525126
MIM 609964
UniProt ID Q8WXI8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLEC4D Products

Required fields are marked with *

My Review for All CLEC4D Products

Required fields are marked with *

0
cart-icon
0
compare icon