Recombinant Human CLEC4D Protein (39-215 aa), His-SUMO-tagged
Cat.No. : | CLEC4D-1083H |
Product Overview : | Recombinant Human CLEC4D Protein (39-215 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 39-215 aa |
Description : | Functions as an endocytic receptor. May be involved in antigen uptake at the site of infection, either for clearance of the antigen, or for processing and further presentation to T cells. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 36.7 kDa |
AA Sequence : | CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | CLEC4D C-type lectin domain family 4, member D [ Homo sapiens ] |
Official Symbol | CLEC4D |
Synonyms | CLEC4D; Mpcl; MCL; MPCL; CLEC6; CLEC-6; CLECSF8; MGC40078; |
Gene ID | 338339 |
mRNA Refseq | NM_080387 |
Protein Refseq | NP_525126 |
MIM | 609964 |
UniProt ID | Q8WXI8 |
◆ Recombinant Proteins | ||
Clec4d-16R | Recombinant Rat Clec4d, Fc tagged | +Inquiry |
CLEC4D-1792R | Recombinant Rhesus Monkey CLEC4D Protein | +Inquiry |
CLEC4D-3209H | Recombinant Human CLEC4D protein(Gly52-Asn215), His-tagged | +Inquiry |
CLEC4D-797H | Recombinant Human CLEC4D Protein, His-tagged | +Inquiry |
CLEC4D-1101R | Recombinant Rat CLEC4D Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
CLEC4D-1487RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
CLEC4D-2242HCL | Recombinant Human CLEC4D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC4D Products
Required fields are marked with *
My Review for All CLEC4D Products
Required fields are marked with *
0
Inquiry Basket