Recombinant Human CLEC4E Protein, GST-tagged
Cat.No. : | CLEC4E-1469H |
Product Overview : | Human CLEC4E full-length ORF ( AAH00715, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein is a downstream target of CCAAT/enhancer binding protein (C/EBP), beta (CEBPB) and may play a role in inflammation. Alternative splice variants have been described but their full-length sequence has not been determined. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 49.83 kDa |
AA Sequence : | MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGINPLNKGKSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLEC4E C-type lectin domain family 4, member E [ Homo sapiens ] |
Official Symbol | CLEC4E |
Synonyms | CLEC4E; C-type lectin domain family 4, member E; C type (calcium dependent, carbohydrate recognition domain) lectin, superfamily member 9 , CLECSF9; C-type lectin domain family 4 member E; mincle; C-type lectin superfamily member 9; macrophage-inducible C-type lectin; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 9; MINCLE; CLECSF9; |
Gene ID | 26253 |
mRNA Refseq | NM_014358 |
Protein Refseq | NP_055173 |
MIM | 609962 |
UniProt ID | Q9ULY5 |
◆ Recombinant Proteins | ||
CLEC4E-2057M | Recombinant Mouse CLEC4E Protein (46-214 aa), His-tagged | +Inquiry |
CLEC4E-1102R | Recombinant Rat CLEC4E Protein, His (Fc)-Avi-tagged | +Inquiry |
CLEC4E-7778H | Recombinant Human CLEC4E Protein, Myc/DDK-tagged | +Inquiry |
CLEC4E-15H | Recombinant Human CLEC4E protein, His-tagged | +Inquiry |
CLEC4E-2077H | Recombinant Human CLEC4E Protein (Arg41-Leu219), N-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4E-7450HCL | Recombinant Human CLEC4E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC4E Products
Required fields are marked with *
My Review for All CLEC4E Products
Required fields are marked with *