Recombinant Human CLEC5C Protein, His-SUMO-tagged
Cat.No. : | CLEC4C-1168H |
Product Overview : | Recombinant Human CLEC4C Protein (45-213aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 45-213 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 36 kDa |
AA Sequence : | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVM GADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIIN FRSSEEWGWNDIHCHVPQKSICKMKKIYI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ] |
Official Symbol | CLEC4C |
Synonyms | DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150 |
Gene ID | 170482 |
mRNA Refseq | NM_203503.1 |
Protein Refseq | NP_987099.1 |
MIM | 606677 |
UniProt ID | Q8WTT0 |
◆ Recombinant Proteins | ||
CLEC4C-2214H | Recombinant Human CLEC4C protein, Fc-tagged | +Inquiry |
CLEC4C-1368H | Recombinant Human CLEC4C protein, His-tagged | +Inquiry |
CLEC4C-026H | Recombinant Human CLEC4C Protein, His-tagged | +Inquiry |
CLEC4C-1379C | Recombinant Cynomolgus CLEC4C protein, mFc-tagged | +Inquiry |
CLEC4C-1033H | Recombinant Human CLEC4C Protein (Ser67-Ile213), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC4C Products
Required fields are marked with *
My Review for All CLEC4C Products
Required fields are marked with *