Recombinant Human CLEC5C Protein, His-SUMO-tagged
| Cat.No. : | CLEC4C-1168H | 
| Product Overview : | Recombinant Human CLEC4C Protein (45-213aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His&SUMO | 
| Protein Length : | 45-213 a.a. | 
| Form : | Tris-based buffer, 50% glycerol. | 
| Molecular Mass : | 36 kDa | 
| AA Sequence : | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVM GADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIIN FRSSEEWGWNDIHCHVPQKSICKMKKIYI  | 
                                
| Purity : | Greater than 90% as determined by SDS-PAGE. | 
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
| Gene Name | CLEC4C C-type lectin domain family 4, member C [ Homo sapiens ] | 
| Official Symbol | CLEC4C | 
| Synonyms | DLEC; HECL; BDCA2; CD303; CLECSF7; CLECSF11; PRO34150 | 
| Gene ID | 170482 | 
| mRNA Refseq | NM_203503.1 | 
| Protein Refseq | NP_987099.1 | 
| MIM | 606677 | 
| UniProt ID | Q8WTT0 | 
| ◆ Recombinant Proteins | ||
| CLEC4C-2214H | Recombinant Human CLEC4C protein, Fc-tagged | +Inquiry | 
| CLEC4C-1368H | Recombinant Human CLEC4C protein, His-tagged | +Inquiry | 
| CLEC4C-026H | Recombinant Human CLEC4C Protein, His-tagged | +Inquiry | 
| CLEC4C-1379C | Recombinant Cynomolgus CLEC4C protein, mFc-tagged | +Inquiry | 
| CLEC4C-1033H | Recombinant Human CLEC4C Protein (Ser67-Ile213), N-His tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All CLEC4C Products
Required fields are marked with *
My Review for All CLEC4C Products
Required fields are marked with *
  
        
    
      
            