Recombinant Human CLECL1 Protein, GST-tagged
Cat.No. : | CLECL1-2382H |
Product Overview : | Human DCAL1 partial ORF ( NP_742001.1, 82 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a type II transmembrane, C-type lectin-like protein that is highly expressed on dendritic and B cells. This protein may act as a T-cell costimulatory molecule that enhances interleukin-4 production, and maybe involved in the regulation of the immune response. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 35.2 kDa |
AA Sequence : | DVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAKDWKVHKGKCYWIAETKKSWNKSQNDCAINNSYLMVIQDITAMVRFNI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLECL1 C-type lectin-like 1 [ Homo sapiens ] |
Official Symbol | CLECL1 |
Synonyms | CLECL1; C-type lectin-like 1; C-type lectin-like domain family 1; DCAL1; dendritic cell associated lectin 1; DCAL-1; DC-associated lectin-1; dendritic cell-associated lectin 1; dendritic cell-associated lectin-1; type II transmembrane protein DCAL1; |
Gene ID | 160365 |
mRNA Refseq | NM_001253748 |
Protein Refseq | NP_001240677 |
MIM | 607467 |
UniProt ID | Q8IZS7 |
◆ Recombinant Proteins | ||
CLECL1-2383H | Recombinant Human CLECL1 protein, His & Myc-tagged | +Inquiry |
CLECL1-2382H | Recombinant Human CLECL1 Protein, GST-tagged | +Inquiry |
CLECL1-02H | Recombinant Human CLECL1 Protein, N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLECL1 Products
Required fields are marked with *
My Review for All CLECL1 Products
Required fields are marked with *
0
Inquiry Basket