Recombinant Human CLGN Protein, GST-tagged
| Cat.No. : | CLGN-1475H | 
| Product Overview : | Human CLGN full-length ORF ( NP_004353.1, 1 a.a. - 610 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility. [provided by RefSeq, Jul 2008] | 
| Molecular Mass : | 96.4 kDa | 
| AA Sequence : | MHFQAFWLCLGLLFISINAEFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CLGN calmegin [ Homo sapiens ] | 
| Official Symbol | CLGN | 
| Synonyms | CLGN; calmegin; | 
| Gene ID | 1047 | 
| mRNA Refseq | NM_001130675 | 
| Protein Refseq | NP_001124147 | 
| MIM | 601858 | 
| UniProt ID | O14967 | 
| ◆ Recombinant Proteins | ||
| CLGN-1660H | Recombinant Human CLGN protein, His & T7-tagged | +Inquiry | 
| CLGN-11323H | Recombinant Human CLGN, GST-tagged | +Inquiry | 
| CLGN-4754Z | Recombinant Zebrafish CLGN | +Inquiry | 
| CLGN-2174HF | Recombinant Full Length Human CLGN Protein, GST-tagged | +Inquiry | 
| CLGN-1690H | Recombinant Human CLGN Protein (Met1-Trp471), N-His tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CLGN-7449HCL | Recombinant Human CLGN 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLGN Products
Required fields are marked with *
My Review for All CLGN Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            