Recombinant Human CLGN Protein, GST-tagged
| Cat.No. : | CLGN-1475H |
| Product Overview : | Human CLGN full-length ORF ( NP_004353.1, 1 a.a. - 610 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneisis and infertility. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 96.4 kDa |
| AA Sequence : | MHFQAFWLCLGLLFISINAEFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWLWLIYLVTAGVPIALITSFCWPRKVKKKHKDTEYKKTDICIPQTKGVLEQEEKEEKAALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEADESTGSGDGPIKSVRKRRVRKD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLGN calmegin [ Homo sapiens ] |
| Official Symbol | CLGN |
| Synonyms | CLGN; calmegin; |
| Gene ID | 1047 |
| mRNA Refseq | NM_001130675 |
| Protein Refseq | NP_001124147 |
| MIM | 601858 |
| UniProt ID | O14967 |
| ◆ Recombinant Proteins | ||
| RFL22812MF | Recombinant Full Length Mouse Calmegin(Clgn) Protein, His-Tagged | +Inquiry |
| CLGN-4754Z | Recombinant Zebrafish CLGN | +Inquiry |
| CLGN-2174HF | Recombinant Full Length Human CLGN Protein, GST-tagged | +Inquiry |
| RFL19240HF | Recombinant Full Length Human Calmegin(Clgn) Protein, His-Tagged | +Inquiry |
| CLGN-1752M | Recombinant Mouse CLGN Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLGN-113HKCL | Human CLGN Knockdown Cell Lysate | +Inquiry |
| CLGN-7449HCL | Recombinant Human CLGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLGN Products
Required fields are marked with *
My Review for All CLGN Products
Required fields are marked with *




