Recombinant Human CLIC3 Protein, GST-tagged
Cat.No. : | CLIC3-1479H |
Product Overview : | Human CLIC3 full-length ORF ( AAH07012, 1 a.a. - 236 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 3 is a member of the p64 family and is predominantly localized in the nucleus and stimulates chloride ion channel activity. In addition, this protein may participate in cellular growth control, based on its association with ERK7, a member of the MAP kinase family. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLIC3 chloride intracellular channel 3 [ Homo sapiens ] |
Official Symbol | CLIC3 |
Synonyms | CLIC3; chloride intracellular channel 3; chloride intracellular channel protein 3; |
Gene ID | 9022 |
mRNA Refseq | NM_004669 |
Protein Refseq | NP_004660 |
MIM | 606533 |
UniProt ID | O95833 |
◆ Recombinant Proteins | ||
CLIC3-2182HF | Recombinant Full Length Human CLIC3 Protein, GST-tagged | +Inquiry |
RFL12342MF | Recombinant Full Length Mouse Chloride Intracellular Channel Protein 3(Clic3) Protein, His-Tagged | +Inquiry |
CLIC3-1479H | Recombinant Human CLIC3 Protein, GST-tagged | +Inquiry |
CLIC3-3259H | Recombinant Human CLIC3 Protein, MYC/DDK-tagged | +Inquiry |
CLIC3-533H | Recombinant Human CLIC3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLIC3-364HCL | Recombinant Human CLIC3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLIC3 Products
Required fields are marked with *
My Review for All CLIC3 Products
Required fields are marked with *
0
Inquiry Basket