Recombinant Human CLIC4 protein, GST-tagged
| Cat.No. : | CLIC4-11327H |
| Product Overview : | Recombinant Human CLIC4 protein(1-253 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | October 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-253 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | CLIC4 chloride intracellular channel 4 [ Homo sapiens ] |
| Official Symbol | CLIC4 |
| Synonyms | CLIC4; chloride intracellular channel 4; chloride intracellular channel protein 4; CLIC4L; DKFZP566G223; H1; huH1; p64H1; P64H1; chloride intracellular channel 4 like; intracellular chloride ion channel protein p64H1; MTCLIC; FLJ38640; DKFZp566G223; |
| Gene ID | 25932 |
| mRNA Refseq | NM_013943 |
| Protein Refseq | NP_039234 |
| MIM | 606536 |
| UniProt ID | Q9Y696 |
| ◆ Recombinant Proteins | ||
| RFL19545BF | Recombinant Full Length Bovine Chloride Intracellular Channel Protein 4(Clic4) Protein, His-Tagged | +Inquiry |
| CLIC4-1450R | Recombinant Rat CLIC4 Protein | +Inquiry |
| CLIC4-1108R | Recombinant Rat CLIC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLIC4-735R | Recombinant Rhesus Macaque CLIC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLIC4-11532Z | Recombinant Zebrafish CLIC4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLIC4-7446HCL | Recombinant Human CLIC4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC4 Products
Required fields are marked with *
My Review for All CLIC4 Products
Required fields are marked with *
